Diaphorina citri psyllid: psy4430

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MNVKVVRLQPFPEKPVAGDVLDLLETIRLVIEESLNQLPFSKMDIVTPTGATYHGLKYERGNCGVSVIRSGEAMEQVQRGPRYD
cccEEEEcEEcccccccccEEHHHHHHHHHHHHHHcccccccEEEEcccccEEEcEEEcccccEEEEECccHHHHHHccccccc
*NVKVVRLQPFPEKPVAGDVLDLLETIRLVIEESLNQLPFSKMDIVTPTGATYHGLKYERGNCGVSVIRSGEA***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVKVVRLQPFPEKPVAGDVLDLLETIRLVIEESLNQLPFSKMDIVTPTGATYHGLKYERGNCGVSVIRSGEAMEQVQRGPRYD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uracil phosphoribosyltransferase homolog confidentQ6NYU7
Uracil phosphoribosyltransferase homolog confidentB1AVZ0
Uracil phosphoribosyltransferase homolog confidentQ5ZIJ8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0004849 [MF]uridine kinase activityprobableGO:0019206, GO:0019205, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0044206 [BP]UMP salvageprobableGO:0044710, GO:0009259, GO:0008152, GO:0009218, GO:0043173, GO:1901564, GO:0072528, GO:0044249, GO:0034641, GO:0009129, GO:0006807, GO:0009163, GO:0009161, GO:0046134, GO:0009123, GO:1901362, GO:0046131, GO:0046132, GO:0072527, GO:0006220, GO:0006221, GO:0006222, GO:1901360, GO:0046049, GO:0008150, GO:0071704, GO:0009124, GO:0046483, GO:0044281, GO:0018130, GO:0006793, GO:0006139, GO:0009156, GO:0009987, GO:0006725, GO:0009220, GO:0055086, GO:0009260, GO:0009058, GO:0009117, GO:0009116, GO:0009173, GO:0019438, GO:0034654, GO:0009130, GO:0009119, GO:0090407, GO:0042455, GO:0010138, GO:0043094, GO:0044238, GO:0044271, GO:1901566, GO:0008655, GO:0009174, GO:1901137, GO:0032262, GO:1901135, GO:0046390, GO:0006213, GO:1901657, GO:0006796, GO:0009165, GO:1901293, GO:1901576, GO:0019637, GO:0019693, GO:0044237, GO:0006753, GO:1901659
GO:0016310 [BP]phosphorylationprobableGO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BD3, chain D
Confidence level:very confident
Coverage over the Query: 4-83
View the alignment between query and template
View the model in PyMOL