Diaphorina citri psyllid: psy4437

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFF
cccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEccccCEccccccc
MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000976 [MF]transcription regulatory region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0009968 [BP]negative regulation of signal transductionprobableGO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0003712 [MF]transcription cofactor activityprobableGO:0003674, GO:0000989, GO:0000988
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050896 [BP]response to stimulusprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 3-77,92-130
View the alignment between query and template
View the model in PyMOL