Psyllid ID: psy4437
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| 270009219 | 511 | lim1 [Tribolium castaneum] | 0.893 | 0.228 | 0.507 | 1e-30 | |
| 189238568 | 497 | PREDICTED: similar to LIM homeobox 1b [T | 0.893 | 0.235 | 0.507 | 2e-30 | |
| 328705917 | 555 | PREDICTED: LIM/homeobox protein Lhx5-lik | 0.885 | 0.209 | 0.421 | 5e-26 | |
| 195456664 | 506 | GK16904 [Drosophila willistoni] gi|19417 | 0.862 | 0.223 | 0.469 | 5e-25 | |
| 198469300 | 528 | GA10943 [Drosophila pseudoobscura pseudo | 0.862 | 0.214 | 0.469 | 6e-25 | |
| 195480019 | 500 | GE17432 [Drosophila yakuba] gi|194188630 | 0.862 | 0.226 | 0.469 | 6e-25 | |
| 194890894 | 504 | GG19023 [Drosophila erecta] gi|190649051 | 0.862 | 0.224 | 0.469 | 6e-25 | |
| 18858205 | 505 | Lim1, isoform A [Drosophila melanogaster | 0.862 | 0.223 | 0.469 | 6e-25 | |
| 194769270 | 500 | GF19125 [Drosophila ananassae] gi|190618 | 0.862 | 0.226 | 0.469 | 6e-25 | |
| 195400977 | 498 | GJ15180 [Drosophila virilis] gi|19414174 | 0.862 | 0.226 | 0.469 | 6e-25 |
| >gi|270009219|gb|EFA05667.1| lim1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 137 bits (345), Expect = 1e-30, Method: Composition-based stats.
Identities = 68/134 (50%), Positives = 82/134 (61%), Gaps = 17/134 (12%)
Query: 1 MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSP 60
MLISCA C+KPILDKFLLNVLERTWHADCVRC+DCH L+DKCFSRE KLFCRNDFFR
Sbjct: 74 MLISCAACDKPILDKFLLNVLERTWHADCVRCFDCHAPLTDKCFSRENKLFCRNDFFRRY 133
Query: 61 VRFPSGCGVGLSSSMLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLS---DKC 117
GCG G+S S L+ A ++ +H +C C C LS +
Sbjct: 134 GTKCGGCGQGISPSDLVRKA--------------RDKVFHLNCFTCLVCRKQLSTGEELY 179
Query: 118 FSREGKLFCRNDFF 131
+ K C++D+
Sbjct: 180 VLDDNKFICKDDYL 193
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189238568|ref|XP_969484.2| PREDICTED: similar to LIM homeobox 1b [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328705917|ref|XP_001945631.2| PREDICTED: LIM/homeobox protein Lhx5-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|195456664|ref|XP_002075233.1| GK16904 [Drosophila willistoni] gi|194171318|gb|EDW86219.1| GK16904 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|198469300|ref|XP_001354984.2| GA10943 [Drosophila pseudoobscura pseudoobscura] gi|198146805|gb|EAL32040.2| GA10943 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195480019|ref|XP_002101106.1| GE17432 [Drosophila yakuba] gi|194188630|gb|EDX02214.1| GE17432 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194890894|ref|XP_001977402.1| GG19023 [Drosophila erecta] gi|190649051|gb|EDV46329.1| GG19023 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|18858205|ref|NP_572505.1| Lim1, isoform A [Drosophila melanogaster] gi|39841014|gb|AAD55417.2|AF181631_1 GH04929p [Drosophila melanogaster] gi|6252420|dbj|BAA86224.1| dLim1 [Drosophila melanogaster] gi|22833027|gb|AAF46413.2| Lim1, isoform A [Drosophila melanogaster] gi|220943666|gb|ACL84376.1| Lim1-PA [synthetic construct] gi|220953602|gb|ACL89344.1| Lim1-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|194769270|ref|XP_001966729.1| GF19125 [Drosophila ananassae] gi|190618250|gb|EDV33774.1| GF19125 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195400977|ref|XP_002059092.1| GJ15180 [Drosophila virilis] gi|194141744|gb|EDW58161.1| GJ15180 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| FB|FBgn0026411 | 505 | Lim1 [Drosophila melanogaster | 0.854 | 0.221 | 0.472 | 2.1e-25 | |
| UNIPROTKB|A6QQY6 | 402 | LHX5 "Uncharacterized protein" | 0.877 | 0.286 | 0.432 | 5.9e-25 | |
| UNIPROTKB|E2RRP3 | 402 | LHX5 "Uncharacterized protein" | 0.877 | 0.286 | 0.432 | 5.9e-25 | |
| UNIPROTKB|Q9H2C1 | 402 | LHX5 "LIM/homeobox protein Lhx | 0.877 | 0.286 | 0.432 | 5.9e-25 | |
| MGI|MGI:107792 | 402 | Lhx5 "LIM homeobox protein 5" | 0.877 | 0.286 | 0.432 | 5.9e-25 | |
| RGD|71079 | 402 | Lhx5 "LIM homeobox 5" [Rattus | 0.877 | 0.286 | 0.432 | 5.9e-25 | |
| UNIPROTKB|F1RKD0 | 401 | LHX5 "Uncharacterized protein" | 0.870 | 0.284 | 0.432 | 3.3e-24 | |
| UNIPROTKB|B7ZP59 | 403 | lhx1 "Homeobox protein" [Xenop | 0.870 | 0.282 | 0.421 | 5.3e-24 | |
| UNIPROTKB|P29674 | 403 | lhx1 "LIM/homeobox protein Lhx | 0.870 | 0.282 | 0.421 | 5.3e-24 | |
| ZFIN|ZDB-GENE-980526-347 | 405 | lhx1a "LIM homeobox 1a" [Danio | 0.870 | 0.281 | 0.421 | 5.3e-24 |
| FB|FBgn0026411 Lim1 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 293 (108.2 bits), Expect = 2.1e-25, P = 2.1e-25
Identities = 61/129 (47%), Positives = 78/129 (60%)
Query: 5 CAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFP 64
CAGC KPILDKFLLNVLER WHA CVRC +C L+DKCFSRE KL+CRNDFFR
Sbjct: 27 CAGCNKPILDKFLLNVLERAWHASCVRCCECLQPLTDKCFSRESKLYCRNDFFRRYGTKC 86
Query: 65 SGCGVGLSSSMLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLS--DKCFSRE- 121
SGCG G++ S L+ KP ++ +H +C C C LS ++ + +
Sbjct: 87 SGCGQGIAPSDLV-----RKP---------RDKVFHLNCFTCCICRKQLSTGEQLYVLDD 132
Query: 122 GKLFCRNDF 130
K C++D+
Sbjct: 133 NKFICKDDY 141
|
|
| UNIPROTKB|A6QQY6 LHX5 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RRP3 LHX5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H2C1 LHX5 "LIM/homeobox protein Lhx5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107792 Lhx5 "LIM homeobox protein 5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|71079 Lhx5 "LIM homeobox 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RKD0 LHX5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZP59 lhx1 "Homeobox protein" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P29674 lhx1 "LIM/homeobox protein Lhx1" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-980526-347 lhx1a "LIM homeobox 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| cd09367 | 52 | cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L | 1e-25 | |
| cd09367 | 52 | cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L | 1e-25 | |
| cd09466 | 56 | cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | 4e-17 | |
| cd09466 | 56 | cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | 4e-17 | |
| cd09368 | 52 | cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L | 4e-17 | |
| cd09368 | 52 | cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L | 4e-17 | |
| cd09371 | 53 | cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | 3e-15 | |
| cd09371 | 53 | cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | 3e-15 | |
| cd09468 | 52 | cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | 2e-14 | |
| cd09468 | 52 | cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | 2e-14 | |
| cd09467 | 55 | cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | 6e-14 | |
| cd09467 | 55 | cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | 6e-14 | |
| cd09370 | 52 | cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | 3e-11 | |
| cd09370 | 52 | cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | 3e-11 | |
| cd09369 | 54 | cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L | 3e-11 | |
| cd09369 | 54 | cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L | 3e-11 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 3e-11 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 3e-11 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 5e-11 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 5e-11 | |
| cd09373 | 54 | cd09373, LIM1_AWH, The first LIM domain of Arrowhe | 1e-10 | |
| cd09373 | 54 | cd09373, LIM1_AWH, The first LIM domain of Arrowhe | 1e-10 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 2e-10 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 5e-10 | |
| cd09462 | 74 | cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 | 4e-09 | |
| cd09462 | 74 | cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 | 4e-09 | |
| cd09463 | 53 | cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 | 1e-08 | |
| cd09463 | 53 | cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 | 1e-08 | |
| cd09386 | 55 | cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( | 1e-08 | |
| cd09386 | 55 | cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( | 1e-08 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 6e-08 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 6e-08 | |
| cd09366 | 55 | cd09366, LIM1_Isl, The first LIM domain of Isl, a | 2e-07 | |
| cd09366 | 55 | cd09366, LIM1_Isl, The first LIM domain of Isl, a | 2e-07 | |
| cd09469 | 64 | cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | 1e-06 | |
| cd09469 | 64 | cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | 1e-06 | |
| cd09470 | 54 | cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | 4e-06 | |
| cd09470 | 54 | cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | 4e-06 | |
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 7e-06 | |
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 7e-06 | |
| cd09329 | 52 | cd09329, LIM3_abLIM, The third LIM domain of actin | 9e-06 | |
| cd09329 | 52 | cd09329, LIM3_abLIM, The third LIM domain of actin | 9e-06 | |
| cd09381 | 56 | cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of L | 1e-05 | |
| cd09381 | 56 | cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of L | 1e-05 | |
| cd09337 | 52 | cd09337, LIM2_Paxillin_like, The second LIM domain | 2e-05 | |
| cd09337 | 52 | cd09337, LIM2_Paxillin_like, The second LIM domain | 2e-05 | |
| cd09388 | 55 | cd09388, LIM1_LMO1_LMO3, The first LIM domain of L | 3e-05 | |
| cd09388 | 55 | cd09388, LIM1_LMO1_LMO3, The first LIM domain of L | 3e-05 | |
| cd09396 | 53 | cd09396, LIM_DA1, The Lim domain of DA1 | 6e-05 | |
| cd09396 | 53 | cd09396, LIM_DA1, The Lim domain of DA1 | 6e-05 | |
| cd09410 | 53 | cd09410, LIM3_Leupaxin, The third LIM domain of Le | 9e-05 | |
| cd09410 | 53 | cd09410, LIM3_Leupaxin, The third LIM domain of Le | 9e-05 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 3e-04 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 3e-04 | |
| cd09457 | 52 | cd09457, LIM2_ENH, The second LIM domain of the En | 4e-04 | |
| cd09457 | 52 | cd09457, LIM2_ENH, The second LIM domain of the En | 4e-04 | |
| cd09406 | 55 | cd09406, LIM1_Leupaxin, The first LIM domain of Le | 4e-04 | |
| cd09406 | 55 | cd09406, LIM1_Leupaxin, The first LIM domain of Le | 4e-04 | |
| cd09408 | 52 | cd09408, LIM2_Leupaxin, The second LIM domain of L | 5e-04 | |
| cd09408 | 52 | cd09408, LIM2_Leupaxin, The second LIM domain of L | 5e-04 | |
| cd09380 | 54 | cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | 6e-04 | |
| cd09380 | 54 | cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | 6e-04 | |
| cd09407 | 52 | cd09407, LIM2_Paxillin, The second LIM domain of p | 7e-04 | |
| cd09407 | 52 | cd09407, LIM2_Paxillin, The second LIM domain of p | 7e-04 | |
| cd09384 | 56 | cd09384, LIM1_LMO2, The first LIM domain of LMO2 ( | 0.002 | |
| cd09384 | 56 | cd09384, LIM1_LMO2, The first LIM domain of LMO2 ( | 0.002 | |
| cd09362 | 52 | cd09362, LIM2_Enigma_like, The second LIM domain o | 0.003 | |
| cd09362 | 52 | cd09362, LIM2_Enigma_like, The second LIM domain o | 0.003 | |
| cd09338 | 53 | cd09338, LIM3_Paxillin_like, The third LIM domain | 0.003 | |
| cd09338 | 53 | cd09338, LIM3_Paxillin_like, The third LIM domain | 0.003 | |
| cd09361 | 52 | cd09361, LIM1_Enigma_like, The first LIM domain of | 0.004 | |
| cd09361 | 52 | cd09361, LIM1_Enigma_like, The first LIM domain of | 0.004 | |
| cd09422 | 62 | cd09422, LIM1_FHL2, The first LIM domain of Four a | 0.004 | |
| cd09422 | 62 | cd09422, LIM1_FHL2, The first LIM domain of Four a | 0.004 |
| >gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
Score = 91.3 bits (227), Expect = 1e-25
Identities = 39/52 (75%), Positives = 46/52 (88%)
Query: 5 CAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDF 56
CAGC++PILDKFLLNVL+R WHA CV+C DC L++KCFSREGKL+CRNDF
Sbjct: 1 CAGCDRPILDKFLLNVLDRAWHAKCVQCCDCKCPLTEKCFSREGKLYCRNDF 52
|
The first LIM domain of Lhx1 (also known as Lim1) and Lhx5. Lhx1 and Lhx5 are closely related members of LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. Lhx1 is required for regulating the vertebrate head organizer, the nervous system, and female reproductive tract development. During embryogenesis in the mouse, Lhx1 is expressed early in mesodermal tissue, then later during urogenital, kidney, liver, and nervous system development. In the adult, expression is restricted to the kidney and brain. A mouse embryos with Lhx1 gene knockout cannot grow normal anterior head structures, kidneys, and gonads, but with normally developed trunk and tail morphology. In the developing nervous system, Lhx1 is required to direct the trajectories of motor axons in the limb. Lhx1 null female mice lack the oviducts and uterus. Lhx5 protein may play complementary or overlapping roles with Lhx1. The expression of Lhx5 in the anterior portion of the mouse neural tube suggests a role in patterning of the forebrain. All LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 52 |
| >gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
| >gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | Back alignment and domain information |
|---|
| >gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | Back alignment and domain information |
|---|
| >gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | Back alignment and domain information |
|---|
| >gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | Back alignment and domain information |
|---|
| >gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | Back alignment and domain information |
|---|
| >gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | Back alignment and domain information |
|---|
| >gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | Back alignment and domain information |
|---|
| >gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | Back alignment and domain information |
|---|
| >gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) | Back alignment and domain information |
|---|
| >gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) | Back alignment and domain information |
|---|
| >gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) | Back alignment and domain information |
|---|
| >gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8 | Back alignment and domain information |
|---|
| >gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8 | Back alignment and domain information |
|---|
| >gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) | Back alignment and domain information |
|---|
| >gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) | Back alignment and domain information |
|---|
| >gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 | Back alignment and domain information |
|---|
| >gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 | Back alignment and domain information |
|---|
| >gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | Back alignment and domain information |
|---|
| >gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | Back alignment and domain information |
|---|
| >gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188770 cd09384, LIM1_LMO2, The first LIM domain of LMO2 (LIM domain only protein 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188770 cd09384, LIM1_LMO2, The first LIM domain of LMO2 (LIM domain only protein 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| KOG1701|consensus | 468 | 99.93 | ||
| KOG4577|consensus | 383 | 99.93 | ||
| KOG1701|consensus | 468 | 99.92 | ||
| KOG2272|consensus | 332 | 99.91 | ||
| KOG2272|consensus | 332 | 99.86 | ||
| KOG1044|consensus | 670 | 99.85 | ||
| KOG1703|consensus | 479 | 99.82 | ||
| KOG1703|consensus | 479 | 99.81 | ||
| KOG1044|consensus | 670 | 99.73 | ||
| KOG1700|consensus | 200 | 99.63 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.63 | |
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.59 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 99.09 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 99.01 | |
| KOG4577|consensus | 383 | 98.94 | ||
| KOG0490|consensus | 235 | 98.2 | ||
| KOG1702|consensus | 264 | 98.11 | ||
| KOG1700|consensus | 200 | 98.09 | ||
| KOG1702|consensus | 264 | 97.65 | ||
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 95.51 | |
| KOG0490|consensus | 235 | 93.81 | ||
| PF08394 | 37 | Arc_trans_TRASH: Archaeal TRASH domain; InterPro: | 92.03 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 89.51 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 88.8 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 87.06 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 86.75 | |
| PF09943 | 101 | DUF2175: Uncharacterized protein conserved in arch | 86.23 | |
| PF10235 | 90 | Cript: Microtubule-associated protein CRIPT; Inter | 85.79 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 85.07 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 84.7 | |
| KOG2462|consensus | 279 | 84.52 | ||
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 83.76 | |
| PF09943 | 101 | DUF2175: Uncharacterized protein conserved in arch | 83.19 | |
| KOG1813|consensus | 313 | 83.03 | ||
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 81.99 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 81.12 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 80.01 |
| >KOG1701|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.9e-27 Score=173.62 Aligned_cols=118 Identities=27% Similarity=0.662 Sum_probs=105.4
Q ss_pred CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc--CcCCeeecccCcCCCCCCCCCCCccccCCCCcccc
Q psy4437 2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF--SREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISC 79 (131)
Q Consensus 2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f--~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C 79 (131)
+.+|..|+++|.|. ++.|+|+.||+.||+|..|.+.|.+..| ..++++||..||+++|+++|+.|+++|.+.+..
T Consensus 334 lekC~~Cg~~I~d~-iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~-- 410 (468)
T KOG1701|consen 334 LEKCNKCGEPIMDR-ILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGK-- 410 (468)
T ss_pred HHHHhhhhhHHHHH-HHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCC--
Confidence 35799999999988 7899999999999999999999999988 377999999999999999999999999987653
Q ss_pred ccCCcccccceeeeecCCcccccCccccccccccccc-----eeccCCeeecCCC
Q psy4437 80 AGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK-----CFSREGKLFCRND 129 (131)
Q Consensus 80 ~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-----~~~~~g~~~C~~c 129 (131)
.+...|.++++.||.+|++|..|+..|+.+ .|..||.++|+.|
T Consensus 411 -------~etvRvvamdr~fHv~CY~CEDCg~~LS~e~e~qgCyPld~HllCk~C 458 (468)
T KOG1701|consen 411 -------DETVRVVAMDRDFHVNCYKCEDCGLLLSSEEEGQGCYPLDGHLLCKTC 458 (468)
T ss_pred -------cceEEEEEccccccccceehhhcCccccccCCCCcceeccCceeechh
Confidence 134456899999999999999999999832 7999999999987
|
|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function | Back alignment and domain information |
|---|
| >PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG2462|consensus | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 131 | ||||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 7e-17 | ||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 5e-15 | ||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 5e-14 | ||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 7e-13 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 5e-14 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 2e-13 | ||
| 1rut_X | 188 | Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L | 3e-10 | ||
| 1rut_X | 188 | Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L | 2e-07 | ||
| 2dfy_X | 195 | Crystal Structure Of A Cyclized Protein Fusion Of L | 4e-10 | ||
| 2dfy_X | 195 | Crystal Structure Of A Cyclized Protein Fusion Of L | 2e-07 | ||
| 2l4z_A | 123 | Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-L | 3e-08 | ||
| 2l4z_A | 123 | Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-L | 1e-07 | ||
| 1m3v_A | 122 | Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And | 4e-08 | ||
| 1m3v_A | 122 | Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And | 2e-07 | ||
| 2xjy_A | 131 | Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 | 7e-08 | ||
| 1j2o_A | 114 | Structure Of Flin2, A Complex Containing The N-Term | 1e-05 | ||
| 1j2o_A | 114 | Structure Of Flin2, A Complex Containing The N-Term | 5e-05 | ||
| 2dj7_A | 80 | Solution Structure Of 3rd Lim Domain Of Actin-Bindi | 9e-05 | ||
| 2dj7_A | 80 | Solution Structure Of 3rd Lim Domain Of Actin-Bindi | 1e-04 | ||
| 1x3h_A | 80 | Solution Structure Of The Lim Domain Of Human Leupa | 7e-04 | ||
| 1x3h_A | 80 | Solution Structure Of The Lim Domain Of Human Leupa | 7e-04 |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
|
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 | Back alignment and structure |
| >pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 | Back alignment and structure |
| >pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 | Back alignment and structure |
| >pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 | Back alignment and structure |
| >pdb|2L4Z|A Chain A, Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-Lim1 (18-82) Length = 123 | Back alignment and structure |
| >pdb|2L4Z|A Chain A, Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-Lim1 (18-82) Length = 123 | Back alignment and structure |
| >pdb|1M3V|A Chain A, Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And The N- Terminal Lim Domain Of Lmo4 Length = 122 | Back alignment and structure |
| >pdb|1M3V|A Chain A, Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And The N- Terminal Lim Domain Of Lmo4 Length = 122 | Back alignment and structure |
| >pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 | Back alignment and structure |
| >pdb|1J2O|A Chain A, Structure Of Flin2, A Complex Containing The N-Terminal Lim Domain Of Lmo2 And Ldb1-Lid Length = 114 | Back alignment and structure |
| >pdb|1J2O|A Chain A, Structure Of Flin2, A Complex Containing The N-Terminal Lim Domain Of Lmo2 And Ldb1-Lid Length = 114 | Back alignment and structure |
| >pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 | Back alignment and structure |
| >pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 | Back alignment and structure |
| >pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 | Back alignment and structure |
| >pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 3e-25 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 3e-17 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 5e-25 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 1e-16 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 5e-06 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 6e-25 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 1e-22 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 4e-13 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 2e-05 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 4e-20 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 2e-04 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 5e-18 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 2e-17 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 2e-17 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 4e-17 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 1e-15 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 4e-11 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 2e-15 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 8e-14 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 7e-15 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 4e-14 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 1e-13 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 2e-12 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 7e-12 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 6e-12 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 1e-11 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 1e-10 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 1e-10 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 2e-10 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 1e-09 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 9e-10 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 1e-08 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 1e-09 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 2e-09 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 2e-09 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 7e-09 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 3e-09 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 1e-08 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 6e-09 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 6e-09 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 4e-08 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 4e-08 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 4e-08 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 5e-08 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 6e-08 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 6e-08 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 8e-08 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 2e-07 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 9e-08 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 2e-07 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 1e-07 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 4e-07 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 2e-07 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 2e-07 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 2e-07 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 3e-07 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 3e-07 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 3e-07 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 3e-07 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 3e-07 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 4e-07 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 4e-07 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 6e-07 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 8e-07 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 8e-07 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 2e-06 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 9e-07 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 9e-07 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 7e-06 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 7e-06 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 8e-06 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 9e-06 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 8e-06 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 8e-06 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 1e-05 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 1e-05 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 3e-05 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 3e-05 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 7e-05 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 1e-04 |
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
Score = 93.1 bits (231), Expect = 3e-25
Identities = 41/130 (31%), Positives = 67/130 (51%), Gaps = 19/130 (14%)
Query: 5 CAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFP 64
CAGC++ ILD+F+L L+R WH+ C++C DCH L+++CFSR ++C++DFF+ RF
Sbjct: 63 CAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFK---RF- 118
Query: 65 SGCGVGLSSSMLISCAGCEKPIL-DKFLLNVLERTWHADCVRCYDCHHTLSDK---CFSR 120
CA C+ I + + + +H C C C L+
Sbjct: 119 -----------GTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLME 167
Query: 121 EGKLFCRNDF 130
+ +L C+ D+
Sbjct: 168 DSRLVCKADY 177
|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 100.0 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 100.0 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 100.0 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.97 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.97 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.97 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.95 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.91 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.87 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.85 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.82 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.8 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.8 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.8 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.79 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.79 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.79 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.79 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.77 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.76 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.75 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.75 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.74 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.74 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.74 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.74 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.73 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.72 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.72 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.71 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.71 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.71 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.71 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.71 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.69 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.69 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.69 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.69 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.69 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.68 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.68 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.67 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.66 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.66 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.66 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.64 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.64 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.64 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.63 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.63 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.62 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.62 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.62 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.62 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.61 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.61 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.6 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.6 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.6 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.59 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.59 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.59 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.59 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.58 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.58 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.58 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.58 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.58 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.57 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.56 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.56 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.56 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.56 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.56 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.55 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.53 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.51 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.51 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.51 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.48 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.47 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.45 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.44 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.44 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.68 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.4 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 90.51 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 89.83 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 87.02 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 85.03 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 82.55 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 80.38 |
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-34 Score=184.35 Aligned_cols=115 Identities=22% Similarity=0.576 Sum_probs=102.3
Q ss_pred CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCCCCCCCCCccccCCCCccccc
Q psy4437 2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCA 80 (131)
Q Consensus 2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~ 80 (131)
.++|++|+++|.+++++.++|+.||++||+|+.|+++|.++.| .++|++||+.||.++++++|.+|+++|.+.+.
T Consensus 3 ~~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~~L~~~~f~~~~g~~yC~~cy~~~~~~~C~~C~~~I~~~~~---- 78 (126)
T 2xqn_T 3 KPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQ---- 78 (126)
T ss_dssp CCBBTTTSSBCCSSCEEEETTEEECGGGSBCTTTCCBCTTSEEEEETTEEEEHHHHHHHSCCBCTTTCSBCCTTSC----
T ss_pred CCCCccCCCEeCCceEEeeCCCCccCCCCCcCCCCCCCCcCEEEeECCEEechHHhCcCcCccCcccCCcCCcCce----
Confidence 5789999999998878999999999999999999999998766 89999999999999999887777777765433
Q ss_pred cCCcccccceeeeecCCccc--ccCccccccccccccc-eeccCCeeecCCCC
Q psy4437 81 GCEKPILDKFLLNVLERTWH--ADCVRCYDCHHTLSDK-CFSREGKLFCRNDF 130 (131)
Q Consensus 81 ~C~~~I~~~~~~~~~~~~~H--~~Cf~C~~C~~~l~~~-~~~~~g~~~C~~cy 130 (131)
+++++++.|| ++||+|..|+++|++. |++.+|++||..+|
T Consensus 79 ----------~~~a~~~~~H~~~~CF~C~~C~~~l~~~~f~~~~~~~yC~~~~ 121 (126)
T 2xqn_T 79 ----------RVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVEC 121 (126)
T ss_dssp ----------EEEETTEEEESSTTTSBCTTTCCBCTTSEEEEETTEEESSHHH
T ss_pred ----------EEECCCCEeeCCCCCcCcCCCCCccCCCeeEeECCEEcchHHh
Confidence 2389999999 9999999999999977 88899999998654
|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 131 | ||||
| d1j2oa1 | 30 | g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus m | 9e-10 | |
| d1j2oa1 | 30 | g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus m | 9e-10 | |
| d1rutx1 | 30 | g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus m | 2e-08 | |
| d1rutx1 | 30 | g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus m | 2e-08 | |
| d2dara2 | 45 | g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En | 0.003 |
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Rhombotin-2 (Lmo2) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 48.2 bits (115), Expect = 9e-10
Identities = 11/29 (37%), Positives = 20/29 (68%)
Query: 1 MLISCAGCEKPILDKFLLNVLERTWHADC 29
L++C GC++ I D++ L +++ WH DC
Sbjct: 2 SLLTCGGCQQNIGDRYFLKAIDQYWHEDC 30
|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.07 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 98.99 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.95 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.94 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.9 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.9 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.89 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.86 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.85 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.85 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.84 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.84 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.82 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.69 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.69 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.67 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.61 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 98.6 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.59 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.56 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.56 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.5 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.48 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 98.48 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.47 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.46 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 98.42 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.42 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 98.41 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.4 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.39 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.39 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.36 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.34 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.31 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.3 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 98.26 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.26 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.26 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 98.25 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.25 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.23 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.21 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.19 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.13 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.12 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.12 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 98.12 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.12 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 98.11 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 98.11 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 98.09 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.06 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.05 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.01 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.96 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.94 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.9 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.89 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.87 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.83 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.83 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.8 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.8 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 97.8 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.79 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.77 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.75 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.72 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.72 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.71 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.71 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.71 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.69 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.68 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.68 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.66 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.65 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.64 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.62 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.59 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.53 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.52 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.51 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.49 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 97.46 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.45 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.45 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.37 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.3 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.29 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.22 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.2 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.15 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.12 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.92 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.81 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.79 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 96.78 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.68 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 96.67 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 96.63 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.54 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.36 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.33 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.32 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.26 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.15 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.08 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.01 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 95.81 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 95.76 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.64 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 95.57 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.45 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 95.33 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.29 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.04 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 95.0 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 94.92 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 93.5 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 91.59 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 91.31 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 90.69 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 90.47 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 87.49 | |
| d1x4la2 | 30 | Four and a half LIM domains protein 2, FHL2 {Human | 83.63 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 82.83 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 82.52 |
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Leupaxin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.26 E-value=1.3e-12 Score=62.92 Aligned_cols=35 Identities=23% Similarity=0.636 Sum_probs=27.7
Q ss_pred cCcCCCCCCCCCCCccccCCCCccccccCCcccccceeeeecCCcccccCc
Q psy4437 54 NDFFRSPVRFPSGCGVGLSSSMLISCAGCEKPILDKFLLNVLERTWHADCV 104 (131)
Q Consensus 54 ~c~~~~~~~~C~~c~~~i~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf 104 (131)
+||.++|+++|.+|+++|.+. . ++|+|++||++||
T Consensus 1 ~DY~~~fapkC~~C~~~I~g~---------------~-v~Al~~~wHpeCF 35 (35)
T d1x3ha1 1 KDFLAMFSPKCGGCNRPVLEN---------------Y-LSAMDTVWHPECF 35 (35)
T ss_dssp CCCCCCCSCBCTTTCCBCCSS---------------C-EEETTEEECTTTC
T ss_pred CcHHHHhChhhhhcCCcccch---------------h-eeecCCccCcccC
Confidence 478999998777777766543 2 3999999999998
|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|