Diaphorina citri psyllid: psy443

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400---

MIEKALETQENNIPDMLCLCGRIYKDKFVESQYKDKQSLANAIHWYRKGFKYKVSLSTSGNIEVMVIRNKNDDRERATQMIEKALETQENNIPDMLCLCGRIYKDKFVESQYKDKQSLANAIHWYRKGFKGRLRSDVVPKTAENFRALCTGEKGFGFKDSTFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGILSMANAGPNTNGSQFFITTVKTAWLDNRHVVFGSVVEGLDVVKKLESMGSQSGKTSKKIVLRSDVVPKTAENFRALCTGEKGFGFKDSTFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGILSMANAGPNTNGSQFFITTVKTAWLDNRHVVFGSVVEGLDVVKKLESMGSQSGKTSKKIVCFN

cHHHHHHHHccccccEEEEccccccHHHHHHHHHcHHHHHHHHHHHHccEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHHHHHccccccccccCECccccccCEEEEEEccccccccEEEEEcccEEEEEccccccccccHHHHHcccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccCEEEEEEEcccccEEEECcccccccccCEEEECccccccccccHHcccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccCEEEEEcccHHHHHHHHccccccccccccCEEcc

*********ENNIPDMLCLCGRIYKDKFVESQYKDKQSLANAIHWYRKGFKYKVSLSTSGNIEVMVIRNKNDDRERATQMIEKA************CLCGRIYKDKFVESQYKDKQSLANAIHWYRKGFKGRLRSDVVPKTAENFRALCTGEKGFGFKDSTFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGILSMANAGPNTNGSQFFITTVKTAWLDNRHVVFGSVVEGLDVVKKLESMGS***KTSKKIVLRSDVVPKTAENFRALCTGEKGFGFKDSTFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGILSMANAGPNTNGSQFFITTVKTAWLDNRHVVFGSVVEGLDVVKK************KKIVCFN

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIEKALETQENNIPDMLCLCGRIYKDKFVESQYKDKQSLANAIHWYRKGFKYKVSLSTSGNIEVMVxxxxxxxxxxxxxxxxxxxxxQENNIPDMLCLCGRIYKDKFVESQYKDKQSLANAIHWYRKGFKGRLRSDVVPKTAENFRALCTGEKGFGFKDSTFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGILSMANAGPNTNGSQFFITTVKTAWLDNRHVVFGSVVEGLDVVKKLESMGSQSGKTSKKIVLRSDVVPKTAENFRALCTGEKGFGFKDSTFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGILSMANAGPNTNGSQFFITTVKTAWLDNRHVVFGSVVEGLDVVKKLESMGSQSGKTSKKIVCFN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peptidyl-prolyl cis-trans isomerase	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	P18253
Peptidyl-prolyl cis-trans isomerase CYP19-2	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	Q9SKQ0
Peptidyl-prolyl cis-trans isomerase F, mitochondrial	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	P29117

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031090 [CC]	organelle membrane	confident	GO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0000413 [BP]	protein peptidyl-prolyl isomerization	confident	GO:0044267, GO:0018208, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0044446 [CC]	intracellular organelle part	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]	nucleus	confident	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003755 [MF]	peptidyl-prolyl cis-trans isomerase activity	confident	GO:0003824, GO:0003674, GO:0016853, GO:0016859
GO:0032991 [CC]	macromolecular complex	confident	GO:0005575
GO:0005886 [CC]	plasma membrane	confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0001666 [BP]	response to hypoxia	probable	GO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045070 [BP]	positive regulation of viral genome replication	probable	GO:0050792, GO:0045069, GO:2000241, GO:0050794, GO:0043902, GO:0043900, GO:0065007, GO:0008150, GO:2000243, GO:0048518, GO:0048524, GO:0050789, GO:0048522
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0048046 [CC]	apoplast	probable	GO:0005575, GO:0005576
GO:0016018 [MF]	cyclosporin A binding	probable	GO:0033218, GO:0003674, GO:0042277, GO:0005488, GO:0008144
GO:0046902 [BP]	regulation of mitochondrial membrane permeability	probable	GO:0006996, GO:0051234, GO:0046907, GO:0016044, GO:0071840, GO:0006810, GO:0016043, GO:0051179, GO:0008150, GO:0061024, GO:0044765, GO:0065007, GO:0044699, GO:0051649, GO:0006839, GO:0044763, GO:0009987, GO:0065008, GO:0007006, GO:0007005, GO:0051641
GO:0090201 [BP]	negative regulation of release of cytochrome c from mitochondria	probable	GO:2001233, GO:0048583, GO:0051129, GO:0051128, GO:0010821, GO:0010823, GO:0023051, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0010646, GO:0009966, GO:0033043, GO:0043067, GO:0065007, GO:0048519, GO:0090199, GO:0009987, GO:0050794, GO:0044763, GO:0010639, GO:0008150, GO:0048523
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005753 [CC]	mitochondrial proton-transporting ATP synthase complex	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0045259, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0016469, GO:0044422
GO:0005759 [CC]	mitochondrial matrix	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0030496 [CC]	midbody	probable	GO:0005575, GO:0044464, GO:0005623
GO:0000166 [MF]	nucleotide binding	probable	GO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0035071 [BP]	salivary gland cell autophagic cell death	probable	GO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0005788 [CC]	endoplasmic reticulum lumen	probable	GO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016607 [CC]	nuclear speck	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0043021 [MF]	ribonucleoprotein complex binding	probable	GO:0003674, GO:0005488
GO:2000276 [BP]	negative regulation of oxidative phosphorylation uncoupler activity	probable	GO:0032410, GO:2000275, GO:0051051, GO:0008150, GO:0022898, GO:0050794, GO:0050789, GO:0032409, GO:0065007, GO:0051049, GO:0048519, GO:0044092, GO:0010155, GO:0034762, GO:0032879, GO:0065009, GO:0043269
GO:0050714 [BP]	positive regulation of protein secretion	probable	GO:0032880, GO:0070201, GO:0032879, GO:0050708, GO:0060341, GO:0051046, GO:0051047, GO:0051049, GO:0051050, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0051222, GO:0051223, GO:0050789, GO:0048522
GO:0005771 [CC]	multivesicular body	probable	GO:0005737, GO:0043231, GO:0043227, GO:0005770, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0071243 [BP]	cellular response to arsenic-containing substance	probable	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0046685, GO:0044699
GO:0003006 [BP]	developmental process involved in reproduction	probable	GO:0032502, GO:0022414, GO:0008150, GO:0000003
GO:0050900 [BP]	leukocyte migration	probable	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0002376, GO:0051674, GO:0008150, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0046686 [BP]	response to cadmium ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0002576 [BP]	platelet degranulation	probable	GO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006278 [BP]	RNA-dependent DNA replication	probable	GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0090324 [BP]	negative regulation of oxidative phosphorylation	probable	GO:0042325, GO:0042326, GO:0019220, GO:0019222, GO:0043467, GO:0045936, GO:0010563, GO:0031323, GO:0050794, GO:0051174, GO:0002082, GO:0065007, GO:0008150, GO:0048519, GO:0009892, GO:0031324, GO:0050789, GO:0048523
GO:0009785 [BP]	blue light signaling pathway	probable	GO:0071482, GO:0071483, GO:0009314, GO:0009416, GO:0007165, GO:0050789, GO:0044699, GO:0051716, GO:0071478, GO:0030522, GO:0009637, GO:0065007, GO:0071214, GO:0009628, GO:0009987, GO:0050794, GO:0044763, GO:0023052, GO:0007154, GO:0044700, GO:0050896, GO:0008150
GO:0019076 [BP]	viral release from host cell	probable	GO:0044703, GO:0019067, GO:0009987, GO:0044764, GO:0022415, GO:0022414, GO:0019058, GO:0008150, GO:0016032, GO:0051704, GO:0000003
GO:0034389 [BP]	lipid particle organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0009704 [BP]	de-etiolation	probable	GO:0032502, GO:0009628, GO:0009639, GO:0044707, GO:0009314, GO:0050896, GO:0009791, GO:0032501, GO:0009416, GO:0008150, GO:0007275, GO:0044699, GO:0009640
GO:2001243 [BP]	negative regulation of intrinsic apoptotic signaling pathway	probable	GO:2001234, GO:0010941, GO:0009968, GO:2001233, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0043067, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0042981, GO:0050789, GO:0048523, GO:2001242
GO:0070301 [BP]	cellular response to hydrogen peroxide	probable	GO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0042542, GO:0050896, GO:0009987, GO:0034614, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0010035, GO:0006979, GO:0044699
GO:0009535 [CC]	chloroplast thylakoid membrane	probable	GO:0055035, GO:0034357, GO:0031976, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0009536, GO:0016020, GO:0044436, GO:0044435, GO:0044434, GO:0005737, GO:0044446, GO:0031984, GO:0042651, GO:0009507, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0009533 [CC]	chloroplast stromal thylakoid	probable	GO:0031976, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0031984, GO:0009532, GO:0009570, GO:0044435, GO:0044434, GO:0005737, GO:0009536, GO:0009507, GO:0005575, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030182 [BP]	neuron differentiation	probable	GO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0009742 [BP]	brassinosteroid mediated signaling pathway	probable	GO:0070887, GO:0071383, GO:0023052, GO:0007165, GO:0043401, GO:0042221, GO:0050789, GO:0014070, GO:0009755, GO:0051716, GO:0033993, GO:0009719, GO:0071310, GO:0065007, GO:0044699, GO:0071495, GO:1901700, GO:0044700, GO:0009987, GO:0071396, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0010033, GO:0071367, GO:1901701, GO:0009741, GO:0071407, GO:0050896, GO:0009725, GO:0008150, GO:0097305, GO:0048545, GO:0097306
GO:0002931 [BP]	response to ischemia	probable	GO:0006950, GO:0008150, GO:0050896
GO:0016575 [BP]	histone deacetylation	probable	GO:0006476, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0035601, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0048646 [BP]	anatomical structure formation involved in morphogenesis	probable	GO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0009543 [CC]	chloroplast thylakoid lumen	probable	GO:0031978, GO:0031976, GO:0031977, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0009536, GO:0044436, GO:0044435, GO:0044434, GO:0005737, GO:0044446, GO:0031984, GO:0009507, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0090200 [BP]	positive regulation of release of cytochrome c from mitochondria	probable	GO:0051130, GO:0010941, GO:0090199, GO:0033043, GO:0009966, GO:0048583, GO:2001233, GO:0010638, GO:0051128, GO:0023051, GO:0043067, GO:0010821, GO:0008150, GO:0010822, GO:0048518, GO:0065007, GO:0010646, GO:0042981, GO:0050789, GO:0050794, GO:0048522
GO:0010849 [BP]	regulation of proton-transporting ATPase activity, rotational mechanism	probable	GO:0009894, GO:0019220, GO:0080090, GO:0032412, GO:0051049, GO:0031323, GO:0034765, GO:0050789, GO:0034762, GO:0043462, GO:0031329, GO:0030811, GO:0032409, GO:0065007, GO:0043269, GO:0065009, GO:0033121, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0019222, GO:0032879, GO:0009118, GO:0051336, GO:1900542, GO:0010155, GO:0022898, GO:0006140
GO:0034967 [CC]	Set3 complex	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044454, GO:0044451, GO:0005694, GO:0000118, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0022626 [CC]	cytosolic ribosome	probable	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0004518 [MF]	nuclease activity	probable	GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0005795 [CC]	Golgi stack	probable	GO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0042026 [BP]	protein refolding	probable	GO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0005802 [CC]	trans-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0019061 [BP]	uncoating of virus	probable	GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0051704
GO:0030168 [BP]	platelet activation	probable	GO:0009987, GO:0007599, GO:0050878, GO:0044707, GO:0006950, GO:0032501, GO:0007596, GO:0009611, GO:0042060, GO:0065007, GO:0001775, GO:0050817, GO:0044763, GO:0008150, GO:0065008, GO:0050896, GO:0044699
GO:0046540 [CC]	U4/U6 x U5 tri-snRNP complex	probable	GO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0071277 [BP]	cellular response to calcium ion	probable	GO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0051592, GO:0044763, GO:0008150, GO:0070887, GO:0042221, GO:0010035, GO:0044699
GO:0071001 [CC]	U4/U6 snRNP	probable	GO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0030260 [BP]	entry into host cell	probable	GO:0040011, GO:0052192, GO:0044419, GO:0051828, GO:0044409, GO:0008150, GO:0052126, GO:0044403, GO:0051806, GO:0051701, GO:0051704
GO:0051082 [MF]	unfolded protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0032780 [BP]	negative regulation of ATPase activity	probable	GO:0009894, GO:0019220, GO:0080090, GO:0031329, GO:0031323, GO:0050789, GO:0043462, GO:0043086, GO:0051346, GO:0030811, GO:0065007, GO:0044092, GO:0065009, GO:0033121, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0019222, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0008637 [BP]	apoptotic mitochondrial changes	probable	GO:0006996, GO:0010259, GO:0009987, GO:0071840, GO:0006915, GO:0016043, GO:0012501, GO:0044763, GO:0044699, GO:0008150, GO:0007569, GO:0007005
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0010940 [BP]	positive regulation of necrotic cell death	probable	GO:0010939, GO:0050794, GO:0048518, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0005758 [CC]	mitochondrial intermembrane space	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0009585 [BP]	red, far-red light phototransduction	probable	GO:0071482, GO:0009314, GO:0071489, GO:0009416, GO:0007165, GO:0050789, GO:0044699, GO:0051716, GO:0009639, GO:0008150, GO:0065007, GO:0071214, GO:0009581, GO:0009582, GO:0009583, GO:0009628, GO:0009987, GO:0007602, GO:0071478, GO:0044763, GO:0010017, GO:0007154, GO:0050794, GO:0044700, GO:0051606, GO:0009605, GO:0050896, GO:0023052
GO:0001932 [BP]	regulation of protein phosphorylation	probable	GO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
5.-.-.-	Isomerases.	probable
5.2.-.-	Cis-trans-isomerases.	probable
5.2.1.-	Cis-trans Isomerases.	probable
5.2.1.8	Peptidylprolyl isomerase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RDD, chain A
Confidence level:very confident
Coverage over the Query: 118-269
View the alignment between query and template
View the model in PyMOL

Template: 2Z6W, chain A
Confidence level:very confident
Coverage over the Query: 256-403
View the alignment between query and template
View the model in PyMOL