Diaphorina citri psyllid: psy4442

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-----

MSAPVSKPCSNVVRHRLTQALVVMVNAALFVKLAQHTYANLFGTFLCNSSKDREDKMVTSQTFSVWKFLNHGSYRNHLYNENNCERVSMLKVLGTMPGIMLYPLREPVYEHKSLVEPSIPKLNGEYYDYVGSTVDGKLCLSNYRLCHQDNNGSNASITFFNIPLGLIENVEIKEVHWLQIVCKDVTSCKKGSGLGHVKPRYSSRSHFTVTLMEPSDRRGGGTEHELSSVSYRNVQSVKTVPYPPCSYRDTSKAEWTTFKQDCTTRILQGEGSKRGKNEPYPRVLYRDTFQSEGHVQKRVTTYLILRMLVQGTFKRGTRSKEVRLYLVYQGPFQCVRLTYRSVLPTGTRSTSEWERMKFDEAPVRWRQCSANQNYELCETYPKYVIVPSGIDDGLLKSSADFRSNQRFPVVVWRHQKNGAVIARSSQPQVGVLGWRKKEDEMLLEQITKAGSGGDESSKRFDRENWNRYDLIVPKAKKEGIGESQPFRERTLPGKDEIRSGWWKAVDGTSWRAPSNTSWWKAVDGTSWLQNMHLLLVSAVNLAATIELESRSVLVHCSDGWDRTPQLVSLAEILLDPYYRTVKGFQVLVEREWLEFGHKFDDRCGRNDKSSERSPVFLQWLDCVYQLLTQFPTEFQFNSMFLFPTEFQFNSMFLGS

cccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccHHHHHHcccccccccccHHccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccEEEECcccccEEEEcccEEEEEEccccccccEEEEcccccEEEEEEEEEEEEEEEEcccccCECccccccccccccCEEEEEEEECcccccccccccccccccccccccccccccccccccccccccccEEEccccEEEECccccccccccccccEEEEcccccccccCEEEcccccEEEEEEcccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHccccccccccEEECcccccccccccccCEEEcccccHHHHHHHHHHcccccccEEEEEccccccEEEccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHcccccccccccEEEEHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccc

*****SKPCSNVVRHRLTQALVVMVNAALFVKLAQHTYANLFGTFLCNSSKDREDKMVTSQTFSVWKFLNHGSYRNHLYNENNCERVSMLKVLGTMPGIMLYPLREPVYEHKSLVEPSIPKLNGEYYDYVGSTVDGKLCLSNYRLCHQDNNGSNASITFFNIPLGLIENVEIKEVHWLQIVCKDVTSCKKGSGLGHVKPRYSSRSHFTVT**************************VKTVPYPPCSYRDTSKAEWTTFKQDCTTRIL************YPRVLYRDTFQSEGHVQKRVTTYLILRMLVQGTFKRGTRSKEVRLYLVYQGPFQCVRLTYRSVLPTGTRSTSEWERMKFDEAPVRWRQCSANQNYELCETYPKYVIVPSGIDDGLLKSSADFRSNQRFPVVVWRHQKNGAVIARSSQPQVGVLGWR****EMLLEQITKAGSGGDESSKRFDRENWNRYDLIVPKAKKEGIGESQPFRERTLPGKDEIRSGWWKAVDGTSWRAPSNTSWWKAVDGTSWLQNMHLLLVSAVNLAATIELESRSVLVHCSDGWDRTPQLVSLAEILLDPYYRTVKGFQVLVEREWLEFGHKFDDRCGRNDKSSERSPVFLQWLDCVYQLLTQFPTEFQFNSMFLFPTEFQFNSMFLGS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0046856 [BP]	phosphatidylinositol dephosphorylation	probable	GO:0044238, GO:0006644, GO:0006650, GO:0016311, GO:0046839, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0006796, GO:0046488, GO:0008152, GO:0006793, GO:0019637, GO:0008150, GO:0046486, GO:0030258, GO:0044255, GO:0006629
GO:0046855 [BP]	inositol phosphate dephosphorylation	probable	GO:0046434, GO:0016311, GO:0046174, GO:0019751, GO:0043647, GO:0044282, GO:0044712, GO:1901575, GO:0044262, GO:0071704, GO:0044281, GO:0046838, GO:0009987, GO:0046164, GO:0044710, GO:0008150, GO:0008152, GO:0009056, GO:0044238, GO:0005975, GO:0044237, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0071545, GO:1901616, GO:1901615
GO:0004438 [MF]	phosphatidylinositol-3-phosphatase activity	probable	GO:0052866, GO:0016791, GO:0016787, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0052744
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LW3, chain A
Confidence level:very confident
Coverage over the Query: 117-188,204-208,221-226,254-256,273-325,345-451,465-655
View the alignment between query and template
View the model in PyMOL

Template: 1LW3, chain A
Confidence level:very confident
Coverage over the Query: 11-107
View the alignment between query and template
View the model in PyMOL