Diaphorina citri psyllid: psy4445

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

HKEVTRESCGDTGKCLQNNDKTLVNKAEAREFCGDIERYSCSNDKTLVSKCTAYDTNNNTDGDLDSYYKFPRSIDNLPQLNCLADLVEELHRIFSDDHVNVDYVKFVMKSYKSNPMEWRKYSKFDKYKYTRNLVDAGNDKFNLMILCWGEGHGSSVHDHADAHCFMTNETKKSLYTSSLNKVSCTLYTRNLVDAGNDKFNLMILCWGEGHGSSVHDHADAHCFMKMLDGCLTETRYAWPQTDEDGEEKPLQVIGKSPLKLNEVCYINGKNSSCKGGLNI

cccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccEEEEEEccccccEEEEEEEcccccccccccccccccccccEEEEEEccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEcccCEEEEEEccccccccccccccEEEEEEEECcccEEEEcccccccCEECcc

*********GDTGKCLQNND*TLVNKAEAREFCGDIERYSCSNDKTLVSKCTAYDTN*NTDGDLDSYYKFPRSIDNLPQLNCLADLVEELHRIFSDDHVNVDYVKFVMKSYKSNPMEWRKYSKFDKYKYTRNLVDAGNDKFNLMILCWGEGHGSSVHDHADAHCFMTNETKKSLYTSSLNKVSCTLYTRNLVDAGNDKFNLMILCWGEGHGSSVHDHADAHCFMKMLDGCLTETRYAWPQ**********QVIGKSPLKLNEVCYINGKNSSCKGGLNI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cysteine dioxygenase 1		confident	Q20893
Cysteine dioxygenase type 1		confident	Q6NWZ9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043200 [BP]	response to amino acid stimulus	probable	GO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0001101, GO:0042221, GO:1901698
GO:0007595 [BP]	lactation	probable	GO:0032941, GO:0007275, GO:0044699, GO:0050878, GO:0048513, GO:0065007, GO:0065008, GO:0030879, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0007589, GO:0006810, GO:0044767, GO:0022414, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0000003, GO:0046903, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0051591 [BP]	response to cAMP	probable	GO:1901700, GO:0009719, GO:0050896, GO:1901698, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0014074, GO:0046683, GO:0014070
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0033762 [BP]	response to glucagon stimulus	probable	GO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0043434, GO:0010033
GO:0051384 [BP]	response to glucocorticoid stimulus	probable	GO:0009719, GO:0033993, GO:0031960, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0008198 [MF]	ferrous iron binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0005506, GO:0046872
GO:0019448 [BP]	L-cysteine catabolic process	probable	GO:0046439, GO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0009069, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:0006082, GO:1901605, GO:0009093, GO:1901606, GO:0009987, GO:0000098, GO:0000096, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0009071, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0044273, GO:0046395, GO:0016054, GO:0044237, GO:0006534, GO:0006790
GO:0045471 [BP]	response to ethanol	probable	GO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ELN, chain A
Confidence level:very confident
Coverage over the Query: 75-146,205-276
View the alignment between query and template
View the model in PyMOL

Template: 3ELN, chain A
Confidence level:confident
Coverage over the Query: 82-190,204-241
View the alignment between query and template
View the model in PyMOL