Diaphorina citri psyllid: psy445


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MLSMNDPSLTDRCAQLSGMLPFDGIGLYEQPKPRFIFKMPRVVPDQKSKFESDELFRRLSRESEVRYTGFRDRPQEERQVRFQNGCREGHTEIAFIATGTNIQLVFNPSISANSYHMAPPSRECDFDKEHGKSVSRFNNALA
cccccccccccHHHHcccccccccccccccccccEEEEccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHccccccEEEEEEEEccCEEEEEcccccccccccccccccccccccccCEEEEcccccc
************CAQLSGMLPFDGIGLYEQPKPRFIFKMPRVVPDQKSKFESDELFRRLSRESEVRYTGFRDRPQEERQVRFQNGCREGHTEIAFIATGTNIQLVFNPSISAN****AP*SRECDFDKEHGKSVSRFNNALA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSMNDPSLTDRCAQLSGMLPFDGIGLYEQPKPRFIFKMPRVVPDQKSKFESDELFRRLSRESEVRYTGFRDRPQEERQVRFQNGCREGHTEIAFIATGTNIQLVFNPSISANSYHMAPPSRECDFDKEHGKSVSRFNNALA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein big brother Regulates the DNA-binding properties of Runt.confidentQ24040
Core-binding factor subunit beta CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.confidentQ13951
Core-binding factor subunit beta CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.confidentQ08024

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0035206 [BP]regulation of hemocyte proliferationprobableGO:0042127, GO:0050793, GO:0050794, GO:0008150, GO:0002682, GO:0051239, GO:0065007, GO:0050789
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1E50, chain B
Confidence level:very confident
Coverage over the Query: 40-138
View the alignment between query and template
View the model in PyMOL