Diaphorina citri psyllid: psy447

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MENMLSHNTSLGSPGMTPSYSMNSVINSCSPQSGSTGTPLGGFSSNMHSMGSINGMNGPNCMSTGSMGYSSNMNAACMGGINSYNTALTTGRAELAENSPSPGALQRVARADKTYRRSYTHAKPPYSYISLITMAIQNSPTKMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWTLHKDSGNMFENGCYLRRQKRFKDDKKEVIRQTHHKSVSPTHHHPTHHHHHHSHHTHHNSHNTHSHQSHDAGGKKSPETKPHLSELAMLGLTKEDAMSAGLLHSDFQQNSYHQSFHQQDSELAAMVASGRCHPHLIPPDHYNHHLKQEYGASAVNHPFPVSRLLPSASAMSAAMAMSADSAKSIDLCKMYEMTGGYSTGGNNDSYYQSSSLYHHSTTTSL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccHcccHHHHccccccccccccccccccccccccccccccccccccccccccccc
**********************************************************************************************************************YTHAKPPYSYISLITMAIQNSPTKMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWTLHKDSGNMFENGCYLR***********************************************************************************************************************************YGASAV*****************************IDLCKMYEMT***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENMLSHNTSLGSPGMTPSYSMNSVINSCSPQSGSTGTPLGGFSSNMHSMGSINGMNGPNCMSTGSMGYSSNMNAACMGGINSYNTALTTGRAELAENSPSPGALQRVARADKTYRRSYTHAKPPYSYISLITMAIQNSPTKMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWTLHKDSGNMFENGCYLRRQKRFKDDKKEVIRQTHHKSVSPTHHHPTHHHHHHSHHTHHNSHNTHSHQSHDAGGKKSPETKPHLSELAMLGLTKEDAMSAGLLHSDFQQNSYHQSFHQQDSELAAMVASGRCHPHLIPPDHYNHHLKQEYGASAVNHPFPVSRLLPSASAMSAAMAMSADSAKSIDLCKMYEMTGGYSTGGNNDSYYQSSSLYHHSTTTSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hepatocyte nuclear factor 3-alpha Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Binds DNA with the consensus sequence 5'-[AC]A[AT]T[AG]TT[GT][AG][CT]T[CT]-3'. Proposed to play a role in translating the epigenetic signatures into cell type-specific enhancer-driven transcriptional programs. Involved in glucose homeostasis; activates the GCG promoter. Involved in the development of multiple endoderm-derived organ systems such as the liver, pancreas, lungs and prostate; FOXA1 and FOXA2 seem to have at least in part redundant roles. Modulates the transcriptional activity of nuclear hormone receptors. Is required for maximal gene activation mediated by AR in the prostate. Negatively regulates AR transactivation via competition with coactivators such as NCOA2. Is involved in ESR1-mediated transcription. Involved in regulation of apoptosis. Involved in cell cycle regulation. Originally discribed as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes.confidentP23512
Protein fork head Fkh promotes terminal as opposed to segmental development. In the absence of fkh, this developmental switch does not occur. The nuclear localization of the fkh protein suggest that fkh regulates the transcription of other, subordinate, genes.confidentP14734

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0014032 [BP]neural crest cell developmentprobableGO:0030154, GO:0048468, GO:0007275, GO:0044699, GO:0014033, GO:0014031, GO:0048864, GO:0048869, GO:0048513, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0048731, GO:0060485, GO:0044707, GO:0048856, GO:0008150
GO:0035072 [BP]ecdysone-mediated induction of salivary gland cell autophagic cell deathprobableGO:0032502, GO:0035081, GO:0016271, GO:0048707, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0010942, GO:0007569, GO:0009653, GO:0007275, GO:0014070, GO:0007559, GO:0007435, GO:0007431, GO:0033993, GO:0007552, GO:0050789, GO:0043067, GO:0048513, GO:0065007, GO:0044699, GO:0048518, GO:0022612, GO:0043068, GO:0010259, GO:0035075, GO:0009886, GO:0035071, GO:0035070, GO:0009987, GO:0009888, GO:0035078, GO:0044767, GO:0012501, GO:0012502, GO:0035272, GO:0044763, GO:0048731, GO:0042221, GO:0036314, GO:0010033, GO:0050794, GO:1901700, GO:0044707, GO:0050896, GO:0048856, GO:0010941, GO:1901654, GO:0008150, GO:0048732, GO:0097305, GO:0048522
GO:0046332 [MF]SMAD bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0001756 [BP]somitogenesisprobableGO:0032502, GO:0007389, GO:0044699, GO:0032501, GO:0009952, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0043009, GO:0009653, GO:0035282, GO:0048646, GO:0061053
GO:0009948 [BP]anterior/posterior axis specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0008150, GO:0003002, GO:0009798, GO:0007275, GO:0044699
GO:0048701 [BP]embryonic cranial skeleton morphogenesisprobableGO:0048598, GO:0048562, GO:0048568, GO:0009790, GO:0048706, GO:0009653, GO:0007275, GO:0044699, GO:0048513, GO:0043009, GO:0048705, GO:0048704, GO:0009887, GO:0032501, GO:0044767, GO:0008150, GO:0044707, GO:0001501, GO:0048856, GO:0032502, GO:0009792, GO:0048731
GO:0072144 [BP]glomerular mesangial cell developmentprobableGO:0072109, GO:0061005, GO:0030154, GO:0048468, GO:0072359, GO:0072358, GO:0061437, GO:0007275, GO:0044699, GO:0072071, GO:0072012, GO:0048869, GO:0001568, GO:0001944, GO:0001822, GO:0072006, GO:0048513, GO:0035850, GO:0030855, GO:0002064, GO:0032502, GO:0032835, GO:0061440, GO:0032501, GO:0060429, GO:0009888, GO:0061448, GO:0044767, GO:0072008, GO:0044763, GO:0001655, GO:0048731, GO:0072001, GO:0072007, GO:0072143, GO:0072141, GO:0044707, GO:0048856, GO:0008150, GO:0009987
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:2000976 [BP]regulation of transcription from RNA polymerase II promoter involved in detection of glucoseprobableGO:0009593, GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0042221, GO:0050789, GO:0009732, GO:0009730, GO:2000112, GO:0019219, GO:0006357, GO:0065007, GO:0010468, GO:1901700, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051594, GO:2001141, GO:0051606, GO:0010033, GO:0009746, GO:0034287, GO:0009743, GO:0034284, GO:0050896, GO:0051252, GO:0009749, GO:0006355, GO:0010556
GO:2000971 [BP]negative regulation of detection of glucoseprobableGO:0048585, GO:0048583, GO:0008150, GO:0065007, GO:0048519, GO:2000970, GO:0050789
GO:0061178 [BP]regulation of insulin secretion involved in cellular response to glucose stimulusprobableGO:0090087, GO:0032879, GO:0060341, GO:0051046, GO:0051049, GO:0002791, GO:0048583, GO:0050796, GO:0032844, GO:0090276, GO:0046883, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789, GO:0050794
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0006338 [BP]chromatin remodelingprobableGO:0006996, GO:0051276, GO:0006325, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0016568
GO:0032355 [BP]response to estradiol stimulusprobableGO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0014070, GO:0009725, GO:0043627, GO:0042221, GO:0097305, GO:0010033, GO:0048545
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0021915 [BP]neural tube developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0043433 [BP]negative regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0044092, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0065009, GO:0051252, GO:0010468
GO:0033148 [BP]positive regulation of intracellular estrogen receptor signaling pathwayprobableGO:0033145, GO:0033146, GO:0033143, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0072011 [BP]glomerular endothelium developmentprobableGO:0072359, GO:0072358, GO:0061437, GO:0007275, GO:0044699, GO:0072012, GO:0001568, GO:0001944, GO:0001822, GO:0072073, GO:0048513, GO:0032502, GO:0060429, GO:0061440, GO:0032501, GO:0032835, GO:0009888, GO:0044767, GO:0008150, GO:0001655, GO:0072001, GO:0072006, GO:0044707, GO:0048856, GO:0048731
GO:0009953 [BP]dorsal/ventral pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0010719 [BP]negative regulation of epithelial to mesenchymal transitionprobableGO:0022604, GO:2000736, GO:0022603, GO:0051129, GO:0051128, GO:0050789, GO:0044699, GO:0060284, GO:0010769, GO:0065007, GO:0010721, GO:0048519, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0051239, GO:0051093, GO:0010717, GO:2000026, GO:0010771, GO:0008150, GO:0048523
GO:0060487 [BP]lung epithelial cell differentiationprobableGO:0032502, GO:0030323, GO:0030324, GO:0030154, GO:0032501, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0030855, GO:0060541, GO:0009987, GO:0060428, GO:0060429, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0035295, GO:0044707, GO:0048856, GO:0060479, GO:0008150
GO:0033132 [BP]negative regulation of glucokinase activityprobableGO:0033673, GO:0051348, GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0033131, GO:0010906, GO:0050789, GO:0043549, GO:0043086, GO:0065007, GO:0044092, GO:0065009, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0010675, GO:0042325, GO:0051338, GO:0006109
GO:0045931 [BP]positive regulation of mitotic cell cycleprobableGO:0007346, GO:0045787, GO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0023019 [BP]signal transduction involved in regulation of gene expressionprobableGO:0044700, GO:0051716, GO:0019222, GO:0008150, GO:0060255, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0010468, GO:0044699
GO:0035470 [BP]positive regulation of vascular wound healingprobableGO:1901342, GO:0051094, GO:0050793, GO:0080134, GO:0048584, GO:0048583, GO:0045765, GO:0045766, GO:0061043, GO:0061041, GO:2000026, GO:0008150, GO:0051239, GO:0090303, GO:0048518, GO:0065007, GO:0022603, GO:0050789
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0003007 [BP]heart morphogenesisprobableGO:0032502, GO:0007507, GO:0009887, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0048341 [BP]paraxial mesoderm formationprobableGO:0032502, GO:0048598, GO:0044707, GO:0048856, GO:0001704, GO:0048332, GO:0007498, GO:0007369, GO:0048339, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0044699, GO:0048729, GO:0007275, GO:0009653, GO:0048340, GO:0048646, GO:0001707
GO:0072112 [BP]glomerular visceral epithelial cell differentiationprobableGO:0061005, GO:0030154, GO:0032501, GO:0061318, GO:0072311, GO:0007275, GO:0044699, GO:0072010, GO:0048869, GO:0001822, GO:0072073, GO:0008150, GO:0048513, GO:0035850, GO:0030855, GO:0032502, GO:0060429, GO:0032835, GO:0009888, GO:0044767, GO:0044763, GO:0001655, GO:0072001, GO:0072006, GO:0044707, GO:0048856, GO:0048731, GO:0009987
GO:0001708 [BP]cell fate specificationprobableGO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0000433 [BP]negative regulation of transcription from RNA polymerase II promoter by glucoseprobableGO:0009991, GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0031667, GO:0010629, GO:0070887, GO:0007154, GO:0000430, GO:0000437, GO:0050789, GO:0044699, GO:0045014, GO:0010605, GO:0045013, GO:0000122, GO:0031670, GO:0050896, GO:2000112, GO:2000113, GO:0008150, GO:0019219, GO:0010556, GO:0065007, GO:0048519, GO:0010468, GO:0046015, GO:0071496, GO:0045934, GO:0060255, GO:0007584, GO:0009987, GO:0009889, GO:0051716, GO:0050794, GO:0045990, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0042221, GO:0019222, GO:0031668, GO:0031669, GO:0009605, GO:0051253, GO:0051252, GO:0000429, GO:0006355, GO:0006357, GO:0044763, GO:0010558, GO:0048523
GO:0000432 [BP]positive regulation of transcription from RNA polymerase II promoter by glucoseprobableGO:0009991, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0051254, GO:0010628, GO:0070887, GO:0007154, GO:0000430, GO:0000436, GO:0044699, GO:0031667, GO:0051716, GO:0010604, GO:0031670, GO:0051171, GO:0009891, GO:2000112, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0046016, GO:0046015, GO:0071496, GO:0045935, GO:0060255, GO:0007584, GO:0009987, GO:0009889, GO:0050794, GO:0045991, GO:0045990, GO:0044763, GO:0045893, GO:2001141, GO:0042221, GO:0031668, GO:0031669, GO:0009605, GO:0080090, GO:0050896, GO:0051252, GO:0000429, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0008150, GO:0048522
GO:0032989 [BP]cellular component morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0033630 [BP]positive regulation of cell adhesion mediated by integrinprobableGO:0045785, GO:0030155, GO:0050794, GO:0033628, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0030193 [BP]regulation of blood coagulationprobableGO:0032101, GO:0080134, GO:0048583, GO:1900046, GO:0061041, GO:0065007, GO:0051239, GO:0008150, GO:0050818, GO:0050789
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0090050 [BP]positive regulation of cell migration involved in sprouting angiogenesisprobableGO:0022603, GO:1901342, GO:0050789, GO:0090049, GO:0045765, GO:0045766, GO:0065007, GO:0048518, GO:2000145, GO:0010632, GO:0030335, GO:0030334, GO:0050793, GO:0050794, GO:0043536, GO:0043535, GO:0040012, GO:0008150, GO:0051239, GO:0032879, GO:0010634, GO:0051272, GO:0051270, GO:0010595, GO:0010594, GO:0040017, GO:0051094, GO:2000026, GO:2000147, GO:0048522
GO:0060441 [BP]epithelial tube branching involved in lung morphogenesisprobableGO:0032502, GO:0030323, GO:0030324, GO:0048754, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0060425, GO:0048513, GO:0048729, GO:0060562, GO:0060541, GO:0009887, GO:0032501, GO:0035239, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0044707, GO:0048856, GO:0048731
GO:0001945 [BP]lymph vessel developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VTN, chain C
Confidence level:very confident
Coverage over the Query: 121-221
View the alignment between query and template
View the model in PyMOL
Template: 1PQ4, chain A
Confidence level:probable
Coverage over the Query: 264-267,278-327
View the alignment between query and template
View the model in PyMOL