Diaphorina citri psyllid: psy4486


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MADDAAKKAKQAEIDRKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRVIEQRCGTHKDWTNADEATVNKILKELWDRAFKLESEKYDLEIIFRVKEAEITELNAQVNDLRGKFIKPTLKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPEWTKVGGDKGKEEES
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHcccccccccccc
*************************************************LLRKKA******************IEQRCGTHKDWTNADEATVNKILKELWDRAFKLESEKYDLEIIFRVKEAEITELNAQVNDLRGKFIKPTLKKVSKYENKFAKLQKKAAEFNFRNQLKVV*******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKAKKGFMTPERKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRCGTHKDWTNADEATVNKILKELWDRAFKLESEKYDLEIIxxxxxxxxxxxxxxxxxxxxxFIKPTLKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPEWTKVGGDKGKEEES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Troponin I 4 Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to muscle actomyosin ATPase activity.very confidentO44572
Troponin I, cardiac muscle Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.confidentP02646
Troponin I Troponin I is the actomyosin ATPase inhibitory subunit present in the thin filament regulatory complex.confidentP05547

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0032989 [BP]cellular component morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005862 [CC]muscle thin filament tropomyosinprobableGO:0015629, GO:0030016, GO:0030017, GO:0043229, GO:0043228, GO:0043226, GO:0005856, GO:0005575, GO:0044430, GO:0005737, GO:0044424, GO:0005865, GO:0036379, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0043292, GO:0044422, GO:0044449

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J1E, chain C
Confidence level:very confident
Coverage over the Query: 34-134,145-158
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 10-85
View the alignment between query and template
View the model in PyMOL