Diaphorina citri psyllid: psy4487

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MLTRNNSGLRRQYSQQETTPYRIPSSDSGVDMRHSTARSRDEELRYYRGELEGSTGNEGSGSIGGKEKQAILDERIKKFLAHPLSWKPSADGKYMIGHMILRKSGDRYPSASSTLGIKVIGGKLLEDGTRGAIIEKVKKGSPADLEGHLLAGDQVIEWNGRSMRGKSFQDVEDIIAESRQEPQVELIVSRRIQPKYAPTLSKDVYERVRDKPSVLVTSPGSPDIHSGRPGRPVPSHHTDHHPITNSSVGGRIQVKFYLDSGTLRLVVTLIHSVKFYLDSGTLRLVVTLMCAASLVPRSNGQPRCPYAKIYLLPDR
cccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEEEcccccccccccccccEEEEcccccccccccEEEEEEcccccHHcccccccccEEEEEcccccccccHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEEEccccEEccccccEEEEEEEEcccccccccccccccEEEEEEcccc
**********************************************************************ILDERIKKFLAHPLSWKPSADGKYMIGHMILRKSGDRYPSASSTLGIKVIGGKLLEDGTRGAIIEKVKKGSPADLEGHLLAGDQVIEWNGRSMRGKSFQDVEDIIAESRQEPQVELIVSRRI***********************************************************************RLVVTLIHSVKFYLDSGTLRLVVTLMCAASLVPRSNGQPRCPYAKIYLLPD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTRNNSGLRRQYSQQETTPYRIPSSDSGVDMRHSTARSRDEELRYYRGELEGSTGNEGSGSIGGKEKQAILDERIKKFLAHPLSWKPSADGKYMIGHMILRKSGDRYPSASSTLGIKVIGGKLLEDGTRGAIIEKVKKGSPADLEGHLLAGDQVIEWNGRSMRGKSFQDVEDIIAESRQEPQVELIVSRRIQPKYAPTLSKDVYERVRDKPSVLVTSPGSPDIHSGRPGRPVPSHHTDHHPITNSSVGGRIQVKFYLDSGTLRLVVTLIHSVKFYLDSGTLRLVVTLMCAASLVPRSNGQPRCPYAKIYLLPDR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045202 [CC]synapseprobableGO:0005575
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WFG, chain A
Confidence level:very confident
Coverage over the Query: 77-193
View the alignment between query and template
View the model in PyMOL
Template: 1V27, chain A
Confidence level:confident
Coverage over the Query: 247-261,281-314
View the alignment between query and template
View the model in PyMOL