Diaphorina citri psyllid: psy4514


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60----
MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGNSGTDICDKLIGCWTPVITQGQ
ccccccccEEEEEEEcccccEEEEEcccccccccEEEEEEcccccccccHHEEEEEccCECccc
MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGNSGTDICDKLIGCWTPV*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGNSGTDICDKLIGCWTPVITQGQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hypoxia up-regulated protein 1 Has a pivotal role in cytoprotective cellular mechanisms triggered by oxygen deprivation (By similarity). May play a role as a molecular chaperone and participate in protein folding.confidentQ7ZUW2
Hypoxia up-regulated protein 1 Has a pivotal role in cytoprotective cellular mechanisms triggered by oxygen deprivation. May play a role as a molecular chaperone and participate in protein folding.confidentQ60432
Hypoxia up-regulated protein 1 (Fragment) Has a pivotal role in cytoprotective cellular mechanisms triggered by oxygen deprivation (By similarity). May play a role as a molecular chaperone and participate in protein folding.confidentQ0VA61

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006987 [BP]activation of signaling protein activity involved in unfolded protein responseprobableGO:0032069, GO:0048522, GO:0019220, GO:0080090, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0031323, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0043085, GO:0009893, GO:0006984, GO:0051716, GO:0006986, GO:0051347, GO:0010604, GO:0051345, GO:0010562, GO:0043549, GO:0034976, GO:0051247, GO:0019219, GO:0071310, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0042325, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0032075, GO:0051174, GO:0006950, GO:0032268, GO:0044763, GO:0051171, GO:0007154, GO:0050794, GO:0010033, GO:0051336, GO:0044700, GO:0042327, GO:0045860, GO:0030968, GO:0050896, GO:0031401, GO:0051338, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0009987, GO:0001932, GO:0001934, GO:0034620
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I33, chain A
Confidence level:confident
Coverage over the Query: 1-63
View the alignment between query and template
View the model in PyMOL