Psyllid ID: psy4514
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| 403183091 | 925 | AAEL017263-PA [Aedes aegypti] | 0.734 | 0.050 | 0.722 | 2e-14 | |
| 328711506 | 889 | PREDICTED: hypoxia up-regulated protein | 0.656 | 0.047 | 0.880 | 2e-14 | |
| 347966682 | 968 | AGAP001827-PA [Anopheles gambiae str. PE | 0.671 | 0.044 | 0.837 | 3e-14 | |
| 322800098 | 949 | hypothetical protein SINV_11855 [Solenop | 0.906 | 0.061 | 0.672 | 3e-14 | |
| 307184299 | 917 | Hypoxia up-regulated protein 1 [Camponot | 0.656 | 0.045 | 0.857 | 3e-14 | |
| 328711504 | 960 | PREDICTED: hypoxia up-regulated protein | 0.656 | 0.043 | 0.880 | 4e-14 | |
| 332031611 | 952 | Hypoxia up-regulated protein 1 [Acromyrm | 0.906 | 0.060 | 0.672 | 6e-14 | |
| 312380207 | 976 | hypothetical protein AND_07786 [Anophele | 0.671 | 0.044 | 0.813 | 8e-14 | |
| 20128923 | 923 | CG2918, isoform A [Drosophila melanogast | 0.656 | 0.045 | 0.809 | 3e-13 | |
| 195477676 | 921 | GE16956 [Drosophila yakuba] gi|194187798 | 0.656 | 0.045 | 0.809 | 3e-13 |
| >gi|403183091|gb|EJY57847.1| AAEL017263-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 83.6 bits (205), Expect = 2e-14, Method: Composition-based stats.
Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 7/54 (12%)
Query: 1 MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGNSGTDICDKLIG 54
MSVDLGSEWMK+ +VSPGVPMEIALNKESKRKTPT +AF G D+LIG
Sbjct: 34 MSVDLGSEWMKIGVVSPGVPMEIALNKESKRKTPTTIAFRNG-------DRLIG 80
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328711506|ref|XP_003244557.1| PREDICTED: hypoxia up-regulated protein 1-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|347966682|ref|XP_321225.3| AGAP001827-PA [Anopheles gambiae str. PEST] gi|333469947|gb|EAA01085.3| AGAP001827-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|322800098|gb|EFZ21204.1| hypothetical protein SINV_11855 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307184299|gb|EFN70757.1| Hypoxia up-regulated protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|328711504|ref|XP_001946466.2| PREDICTED: hypoxia up-regulated protein 1-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332031611|gb|EGI71083.1| Hypoxia up-regulated protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|312380207|gb|EFR26271.1| hypothetical protein AND_07786 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|20128923|ref|NP_569995.1| CG2918, isoform A [Drosophila melanogaster] gi|281359726|ref|NP_001162645.1| CG2918, isoform B [Drosophila melanogaster] gi|2661598|emb|CAA15711.1| EG:25E8.1 [Drosophila melanogaster] gi|7290308|gb|AAF45769.1| CG2918, isoform A [Drosophila melanogaster] gi|20151397|gb|AAM11058.1| GH11566p [Drosophila melanogaster] gi|220947160|gb|ACL86123.1| CG2918-PA [synthetic construct] gi|272505940|gb|ACZ95182.1| CG2918, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195477676|ref|XP_002100274.1| GE16956 [Drosophila yakuba] gi|194187798|gb|EDX01382.1| GE16956 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| FB|FBgn0023529 | 923 | CG2918 [Drosophila melanogaste | 0.656 | 0.045 | 0.809 | 7.7e-13 | |
| UNIPROTKB|J3KTF1 | 224 | HYOU1 "Hypoxia up-regulated pr | 0.578 | 0.165 | 0.837 | 4.5e-11 | |
| UNIPROTKB|J3QL06 | 211 | HYOU1 "Hypoxia up-regulated pr | 0.578 | 0.175 | 0.837 | 4.5e-11 | |
| ZFIN|ZDB-GENE-030131-5344 | 980 | hyou1 "hypoxia up-regulated 1" | 0.578 | 0.037 | 0.864 | 7e-11 | |
| UNIPROTKB|E9PJ21 | 656 | HYOU1 "Hypoxia up-regulated pr | 0.578 | 0.056 | 0.837 | 1.7e-10 | |
| UNIPROTKB|E9PL22 | 937 | HYOU1 "Hypoxia up-regulated pr | 0.578 | 0.039 | 0.837 | 4.5e-10 | |
| UNIPROTKB|Q9Y4L1 | 999 | HYOU1 "Hypoxia up-regulated pr | 0.578 | 0.037 | 0.837 | 5.3e-10 | |
| UNIPROTKB|E2RB31 | 996 | HYOU1 "Uncharacterized protein | 0.578 | 0.037 | 0.837 | 8.5e-10 | |
| MGI|MGI:108030 | 999 | Hyou1 "hypoxia up-regulated 1" | 0.578 | 0.037 | 0.837 | 8.6e-10 | |
| RGD|621146 | 999 | Hyou1 "hypoxia up-regulated 1" | 0.578 | 0.037 | 0.837 | 1.1e-09 |
| FB|FBgn0023529 CG2918 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 182 (69.1 bits), Expect = 7.7e-13, P = 7.7e-13
Identities = 34/42 (80%), Positives = 38/42 (90%)
Query: 1 MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKG 42
MSVDLGSEWMKV +VSPGVPMEIALN+ESKRKTP ++AF G
Sbjct: 23 MSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDG 64
|
|
| UNIPROTKB|J3KTF1 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QL06 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5344 hyou1 "hypoxia up-regulated 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PJ21 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PL22 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y4L1 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RB31 HYOU1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:108030 Hyou1 "hypoxia up-regulated 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|621146 Hyou1 "hypoxia up-regulated 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| cd10230 | 388 | cd10230, HYOU1-like_NBD, Nucleotide-binding domain | 4e-23 | |
| cd11732 | 377 | cd11732, HSP105-110_like_NBD, Nucleotide-binding d | 1e-11 | |
| COG0443 | 579 | COG0443, DnaK, Molecular chaperone [Posttranslatio | 2e-05 | |
| cd10228 | 381 | cd10228, HSPA4_like_NDB, Nucleotide-binding domain | 8e-05 | |
| PRK13411 | 653 | PRK13411, PRK13411, molecular chaperone DnaK; Prov | 6e-04 | |
| PRK13410 | 668 | PRK13410, PRK13410, molecular chaperone DnaK; Prov | 0.003 |
| >gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins | Back alignment and domain information |
|---|
Score = 88.8 bits (221), Expect = 4e-23
Identities = 29/42 (69%), Positives = 35/42 (83%)
Query: 1 MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKG 42
+ +DLGSEW+KVA+V PGVP EI LN+ESKRKTP+ VAF G
Sbjct: 1 LGIDLGSEWIKVALVKPGVPFEIVLNEESKRKTPSAVAFKGG 42
|
This subgroup includes human HYOU1 (also known as human hypoxia up-regulated 1, GRP170; HSP12A; ORP150; GRP-170; ORP-150; the human HYOU1 gene maps to11q23.1-q23.3) and Saccharomyces cerevisiae Lhs1p (also known as Cer1p, SsI1). Mammalian HYOU1 functions as a nucleotide exchange factor (NEF) for HSPA5 (alos known as BiP, Grp78 or HspA5) and may also function as a HSPA5-independent chaperone. S. cerevisiae Lhs1p, does not have a detectable endogenous ATPase activity like canonical HSP70s, but functions as a NEF for Kar2p; it's interaction with Kar2p is stimulated by nucleotide-binding. In addition, Lhs1p has a nucleotide-independent holdase activity that prevents heat-induced aggregation of proteins in vitro. This subgroup belongs to the 105/110 kDa heat shock protein (HSP105/110) subfamily of the HSP70-like family. HSP105/110s are believed to function generally as co-chaperones of HSP70 chaperones, acting as NEFs, to remove ADP from their HSP70 chaperone partners during the ATP hydrolysis cycle. HSP70 chaperones assist in protein folding and assembly, and can direct incompetent "client" proteins towards degradation. Like HSP70 chaperones, HSP105/110s have an N-terminal nucleotide-binding domain (NBD) and a C-terminal substrate-binding domain (SBD). For HSP70 chaperones, the nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. Hsp70 chaperone activity is also regulated by J-domain proteins. Length = 388 |
| >gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| KOG0100|consensus | 663 | 99.92 | ||
| PTZ00009 | 653 | heat shock 70 kDa protein; Provisional | 99.82 | |
| PTZ00400 | 663 | DnaK-type molecular chaperone; Provisional | 99.81 | |
| PRK13410 | 668 | molecular chaperone DnaK; Provisional | 99.8 | |
| PRK13411 | 653 | molecular chaperone DnaK; Provisional | 99.8 | |
| PTZ00186 | 657 | heat shock 70 kDa precursor protein; Provisional | 99.8 | |
| PRK00290 | 627 | dnaK molecular chaperone DnaK; Provisional | 99.8 | |
| PLN03184 | 673 | chloroplast Hsp70; Provisional | 99.79 | |
| CHL00094 | 621 | dnaK heat shock protein 70 | 99.79 | |
| TIGR02350 | 595 | prok_dnaK chaperone protein DnaK. Members of this | 99.79 | |
| TIGR01991 | 599 | HscA Fe-S protein assembly chaperone HscA. The Hea | 99.79 | |
| PRK05183 | 616 | hscA chaperone protein HscA; Provisional | 99.78 | |
| COG0443 | 579 | DnaK Molecular chaperone [Posttranslational modifi | 99.78 | |
| PF00012 | 602 | HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho | 99.74 | |
| KOG0101|consensus | 620 | 99.73 | ||
| KOG0102|consensus | 640 | 99.72 | ||
| KOG0104|consensus | 902 | 99.66 | ||
| PRK11678 | 450 | putative chaperone; Provisional | 99.66 | |
| PRK01433 | 595 | hscA chaperone protein HscA; Provisional | 99.64 | |
| KOG0103|consensus | 727 | 99.63 | ||
| PRK13929 | 335 | rod-share determining protein MreBH; Provisional | 98.98 | |
| TIGR00904 | 333 | mreB cell shape determining protein, MreB/Mrl fami | 98.8 | |
| PRK13928 | 336 | rod shape-determining protein Mbl; Provisional | 98.71 | |
| PRK13930 | 335 | rod shape-determining protein MreB; Provisional | 98.56 | |
| PRK13927 | 334 | rod shape-determining protein MreB; Provisional | 98.52 | |
| COG1077 | 342 | MreB Actin-like ATPase involved in cell morphogene | 98.31 | |
| PF06723 | 326 | MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba | 98.18 | |
| PF00370 | 245 | FGGY_N: FGGY family of carbohydrate kinases, N-ter | 95.25 | |
| cd00012 | 371 | ACTIN Actin; An ubiquitous protein involved in the | 94.04 | |
| TIGR00241 | 248 | CoA_E_activ CoA-substrate-specific enzyme activase | 93.92 | |
| PRK10331 | 470 | L-fuculokinase; Provisional | 93.19 | |
| PRK15027 | 484 | xylulokinase; Provisional | 93.18 | |
| TIGR02628 | 465 | fuculo_kin_coli L-fuculokinase. Members of this fa | 92.92 | |
| TIGR01314 | 505 | gntK_FGGY gluconate kinase, FGGY type. Gluconate i | 92.76 | |
| TIGR01315 | 541 | 5C_CHO_kinase FGGY-family pentulose kinase. This m | 92.29 | |
| PTZ00294 | 504 | glycerol kinase-like protein; Provisional | 92.29 | |
| PRK10939 | 520 | autoinducer-2 (AI-2) kinase; Provisional | 92.24 | |
| COG1070 | 502 | XylB Sugar (pentulose and hexulose) kinases [Carbo | 92.15 | |
| PRK04123 | 548 | ribulokinase; Provisional | 92.03 | |
| TIGR01311 | 493 | glycerol_kin glycerol kinase. This model describes | 92.02 | |
| TIGR01234 | 536 | L-ribulokinase L-ribulokinase. This enzyme catalyz | 91.73 | |
| smart00732 | 99 | YqgFc Likely ribonuclease with RNase H fold. YqgF | 91.66 | |
| PRK00047 | 498 | glpK glycerol kinase; Provisional | 91.56 | |
| TIGR02261 | 262 | benz_CoA_red_D benzoyl-CoA reductase, bcr type, su | 91.45 | |
| PLN02295 | 512 | glycerol kinase | 91.22 | |
| TIGR01312 | 481 | XylB D-xylulose kinase. D-xylulose kinase (XylB) g | 90.6 | |
| TIGR03192 | 293 | benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s | 90.19 | |
| TIGR02627 | 454 | rhamnulo_kin rhamnulokinase. This model describes | 89.88 | |
| PLN00130 | 213 | succinate dehydrogenase (SDH3); Provisional | 89.72 | |
| smart00268 | 373 | ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki | 88.93 | |
| PLN02669 | 556 | xylulokinase | 88.91 | |
| PTZ00280 | 414 | Actin-related protein 3; Provisional | 88.86 | |
| PRK13321 | 256 | pantothenate kinase; Reviewed | 87.66 | |
| PRK13317 | 277 | pantothenate kinase; Provisional | 87.3 | |
| PRK13318 | 258 | pantothenate kinase; Reviewed | 87.16 | |
| PF14450 | 120 | FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B | 86.14 | |
| smart00842 | 187 | FtsA Cell division protein FtsA. FtsA is essential | 85.76 | |
| PF06277 | 473 | EutA: Ethanolamine utilisation protein EutA; Inter | 84.37 | |
| PTZ00452 | 375 | actin; Provisional | 84.16 | |
| PTZ00281 | 376 | actin; Provisional | 84.14 | |
| TIGR02259 | 432 | benz_CoA_red_A benzoyl-CoA reductase, bcr type, su | 83.98 | |
| TIGR03286 | 404 | methan_mark_15 putative methanogenesis marker prot | 83.87 | |
| COG1924 | 396 | Activator of 2-hydroxyglutaryl-CoA dehydratase (HS | 83.63 | |
| PTZ00004 | 378 | actin-2; Provisional | 81.85 | |
| PTZ00466 | 380 | actin-like protein; Provisional | 81.67 | |
| PF00349 | 206 | Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo | 81.26 | |
| PRK10719 | 475 | eutA reactivating factor for ethanolamine ammonia | 80.94 | |
| PF01548 | 144 | DEDD_Tnp_IS110: Transposase; InterPro: IPR002525 T | 80.21 |
| >KOG0100|consensus | Back alignment and domain information |
|---|
Probab=99.92 E-value=3.6e-26 Score=158.46 Aligned_cols=61 Identities=28% Similarity=0.337 Sum_probs=59.8
Q ss_pred CeeecCCccEEEEEEcCCCceEEEeCCCCCCccceEEEecCCceEEchhHHhhhhcCCCCcc
Q psy4514 1 MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGNSGTDICDKLIGCWTPVITQ 62 (64)
Q Consensus 1 iGIDlGt~~s~va~~~~g~~~~iv~n~~g~r~tpS~V~f~~~~r~vG~~Ak~~~~~nP~nt~ 62 (64)
||||||||||||+++++| .+||+.|++|+|+|||+|+|++++||+|++||+|+..||+||+
T Consensus 39 igIdLGTTYsCVgV~kNg-rvEIiANdQGNRItPSyVaFt~derLiGdAAKNQ~~~NPenTi 99 (663)
T KOG0100|consen 39 IGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTDDERLIGDAAKNQLTSNPENTI 99 (663)
T ss_pred EEEecCCceeeEEEEeCC-eEEEEecCCCCccccceeeeccchhhhhhHhhcccccCcccce
Confidence 699999999999999999 9999999999999999999999999999999999999999997
|
|
| >PTZ00009 heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00400 DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK13410 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK13411 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PTZ00186 heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >PRK00290 dnaK molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PLN03184 chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >CHL00094 dnaK heat shock protein 70 | Back alignment and domain information |
|---|
| >TIGR02350 prok_dnaK chaperone protein DnaK | Back alignment and domain information |
|---|
| >TIGR01991 HscA Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >PRK05183 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins | Back alignment and domain information |
|---|
| >KOG0101|consensus | Back alignment and domain information |
|---|
| >KOG0102|consensus | Back alignment and domain information |
|---|
| >KOG0104|consensus | Back alignment and domain information |
|---|
| >PRK11678 putative chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK01433 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >KOG0103|consensus | Back alignment and domain information |
|---|
| >PRK13929 rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
| >TIGR00904 mreB cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >PRK13928 rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >PRK13930 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PRK13927 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes | Back alignment and domain information |
|---|
| >PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related | Back alignment and domain information |
|---|
| >cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton | Back alignment and domain information |
|---|
| >TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative | Back alignment and domain information |
|---|
| >PRK10331 L-fuculokinase; Provisional | Back alignment and domain information |
|---|
| >PRK15027 xylulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02628 fuculo_kin_coli L-fuculokinase | Back alignment and domain information |
|---|
| >TIGR01314 gntK_FGGY gluconate kinase, FGGY type | Back alignment and domain information |
|---|
| >TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase | Back alignment and domain information |
|---|
| >PTZ00294 glycerol kinase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10939 autoinducer-2 (AI-2) kinase; Provisional | Back alignment and domain information |
|---|
| >COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04123 ribulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01311 glycerol_kin glycerol kinase | Back alignment and domain information |
|---|
| >TIGR01234 L-ribulokinase L-ribulokinase | Back alignment and domain information |
|---|
| >smart00732 YqgFc Likely ribonuclease with RNase H fold | Back alignment and domain information |
|---|
| >PRK00047 glpK glycerol kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D | Back alignment and domain information |
|---|
| >PLN02295 glycerol kinase | Back alignment and domain information |
|---|
| >TIGR01312 XylB D-xylulose kinase | Back alignment and domain information |
|---|
| >TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit | Back alignment and domain information |
|---|
| >TIGR02627 rhamnulo_kin rhamnulokinase | Back alignment and domain information |
|---|
| >PLN00130 succinate dehydrogenase (SDH3); Provisional | Back alignment and domain information |
|---|
| >smart00268 ACTIN Actin | Back alignment and domain information |
|---|
| >PLN02669 xylulokinase | Back alignment and domain information |
|---|
| >PTZ00280 Actin-related protein 3; Provisional | Back alignment and domain information |
|---|
| >PRK13321 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK13317 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13318 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T | Back alignment and domain information |
|---|
| >smart00842 FtsA Cell division protein FtsA | Back alignment and domain information |
|---|
| >PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon | Back alignment and domain information |
|---|
| >PTZ00452 actin; Provisional | Back alignment and domain information |
|---|
| >PTZ00281 actin; Provisional | Back alignment and domain information |
|---|
| >TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A | Back alignment and domain information |
|---|
| >TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 | Back alignment and domain information |
|---|
| >COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PTZ00004 actin-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00466 actin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) | Back alignment and domain information |
|---|
| >PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional | Back alignment and domain information |
|---|
| >PF01548 DEDD_Tnp_IS110: Transposase; InterPro: IPR002525 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 99.8 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 99.79 | |
| 4b9q_A | 605 | Chaperone protein DNAK; HET: ATP; 2.40A {Escherich | 99.77 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 99.77 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 99.74 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 99.73 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 99.72 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 99.71 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 99.71 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 99.03 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 97.59 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 97.26 | |
| 4ehu_A | 276 | Activator of 2-hydroxyisocaproyl-COA dehydratase; | 97.16 | |
| 2ych_A | 377 | Competence protein PILM; cell cycle, type IV pilus | 96.58 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 96.4 | |
| 2zgy_A | 320 | Plasmid segregation protein PARM; plasmid partitio | 95.54 | |
| 2fsj_A | 346 | Hypothetical protein TA0583; actin homologs, archa | 94.28 | |
| 1hux_A | 270 | Activator of (R)-2-hydroxyglutaryl-COA dehydratase | 93.26 | |
| 3ifr_A | 508 | Carbohydrate kinase, FGGY; xylulose kinase, SGX, s | 92.85 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 92.53 | |
| 3ezw_A | 526 | Glycerol kinase; glycerol metabolism, allosteric r | 91.83 | |
| 3l0q_A | 554 | Xylulose kinase; xlylulose kinase, SGX, PSI, struc | 91.47 | |
| 2w40_A | 503 | Glycerol kinase, putative; closed conformation, ma | 91.46 | |
| 3h6e_A | 482 | Carbohydrate kinase, FGGY; novosphingobium aromati | 91.41 | |
| 3ll3_A | 504 | Gluconate kinase; xylulose kinase, nysgx, ATP, ADP | 91.39 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 91.39 | |
| 2uyt_A | 489 | Rhamnulokinase; rhamnose degradation, IN-LINE phos | 91.39 | |
| 4bc3_A | 538 | Xylulose kinase; transferase, glucuronate xyluloki | 91.37 | |
| 2dpn_A | 495 | Glycerol kinase; thermus thermophilus HB8, structu | 91.35 | |
| 2p3r_A | 510 | Glycerol kinase; glycerol metabolism, allosteric r | 91.29 | |
| 2itm_A | 484 | Xylulose kinase, xylulokinase; ATPase, FGGY kinase | 91.27 | |
| 3g25_A | 501 | Glycerol kinase; IDP00743, ATP-binding, glycerol m | 91.06 | |
| 2zf5_O | 497 | Glycerol kinase; hyperthermophilic archaeon, ATP-b | 90.96 | |
| 3jvp_A | 572 | Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su | 90.79 | |
| 4e1j_A | 520 | Glycerol kinase; structural genomics, PSI-biology, | 90.74 | |
| 3h3n_X | 506 | Glycerol kinase; ATP-binding, glycerol metabolism, | 90.7 | |
| 3hz6_A | 511 | Xylulokinase; xylulose, structural genomic, chromo | 90.57 | |
| 2d4w_A | 504 | Glycerol kinase; alpha and beta protein, ribonucle | 90.28 | |
| 2ews_A | 287 | Pantothenate kinase; PANK, structural genomics, st | 88.81 | |
| 3djc_A | 266 | Type III pantothenate kinase; structural genomics, | 88.15 | |
| 1zxo_A | 291 | Conserved hypothetical protein Q8A1P1; NESG, BTR25 | 87.89 | |
| 1zbs_A | 291 | Hypothetical protein PG1100; alpha-beta protein., | 87.44 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 87.13 | |
| 1vhx_A | 150 | Putative holliday junction resolvase; structural g | 83.27 | |
| 1zc6_A | 305 | Probable N-acetylglucosamine kinase; NESG, Q7NU07_ | 82.86 | |
| 2yhx_A | 457 | Hexokinase B; transferase(phosphoryl,alcohol accep | 81.54 | |
| 3bex_A | 249 | Type III pantothenate kinase; actin-like fold, ATP | 81.35 | |
| 2e2o_A | 299 | Hexokinase; acetate and sugar kinases, HSP70, acti | 81.29 | |
| 1bdg_A | 451 | Hexokinase; phosphotransferase; HET: GLC; 2.60A {S | 81.11 |
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
Probab=99.80 E-value=2.7e-20 Score=132.34 Aligned_cols=62 Identities=24% Similarity=0.242 Sum_probs=59.2
Q ss_pred CeeecCCccEEEEEEcCCCceEEEeCCCCCCccceEEEecCCceEEchhHHhhhhcCCCCccC
Q psy4514 1 MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGNSGTDICDKLIGCWTPVITQG 63 (64)
Q Consensus 1 iGIDlGt~~s~va~~~~g~~~~iv~n~~g~r~tpS~V~f~~~~r~vG~~Ak~~~~~nP~nt~~ 63 (64)
|||||||||||||++++| +++|++|++|+|+|||+|+|.++++++|+.|++++..||+||+.
T Consensus 5 iGIDlGTtns~va~~~~g-~~~ii~n~~g~r~tPS~Vaf~~~~~~vG~~A~~~~~~~p~~ti~ 66 (675)
T 3d2f_A 5 FGLDLGNNNSVLAVARNR-GIDIVVNEVSNRSTPSVVGFGPKNRYLGETGKNKQTSNIKNTVA 66 (675)
T ss_dssp EEEECCSSEEEEEEEETT-EEEEECCTTSCSSEECCEEECSSSEEETHHHHHHHTTCGGGEEC
T ss_pred EEEEcCCCcEEEEEEECC-eeEEEECCCCCcccceEEEECCCcEEecHHHHHhhhhChHhHHH
Confidence 699999999999999999 88999999999999999999988999999999999999999874
|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* | Back alignment and structure |
|---|
| >4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* | Back alignment and structure |
|---|
| >1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 | Back alignment and structure |
|---|
| >3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* | Back alignment and structure |
|---|
| >3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* | Back alignment and structure |
|---|
| >2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* | Back alignment and structure |
|---|
| >3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} | Back alignment and structure |
|---|
| >2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* | Back alignment and structure |
|---|
| >4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* | Back alignment and structure |
|---|
| >2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A | Back alignment and structure |
|---|
| >3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* | Back alignment and structure |
|---|
| >2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* | Back alignment and structure |
|---|
| >2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} | Back alignment and structure |
|---|
| >2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 | Back alignment and structure |
|---|
| >3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
| >1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 | Back alignment and structure |
|---|
| >1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A | Back alignment and structure |
|---|
| >3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A | Back alignment and structure |
|---|
| >2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* | Back alignment and structure |
|---|
| >1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 64 | ||||
| d1bupa1 | 185 | c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas | 3e-07 | |
| d1dkgd1 | 183 | c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas | 1e-04 |
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Cow (Bos taurus) [TaxId: 9913]
Score = 42.7 bits (100), Expect = 3e-07
Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%)
Query: 3 VDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGN 43
+DLGS + V + G EI N + R TP+ VAF
Sbjct: 6 IDLGSTYSCVGVFQHGKV-EIIANDQGNRTTPSYVAFTDTE 45
|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| d1bupa1 | 185 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 99.84 | |
| d1dkgd1 | 183 | Heat shock protein 70kDa, ATPase fragment {Escheri | 99.8 | |
| d1jcea1 | 137 | Prokaryotic actin homolog MreB {Thermotoga maritim | 98.96 | |
| d1huxa_ | 259 | Hydroxyglutaryl-CoA dehydratase component A {Acida | 96.03 | |
| d2p3ra1 | 252 | Glycerol kinase {Escherichia coli [TaxId: 562]} | 94.91 | |
| d2ewsa1 | 267 | Type II pantothenate kinase, CoaW {Staphylococcus | 94.9 | |
| d1zc6a1 | 114 | Probable N-acetylglucosamine kinase CV2896 {Chromo | 94.36 | |
| d1r59o1 | 252 | Glycerol kinase {Enterococcus casseliflavus [TaxId | 94.18 | |
| d2ap1a2 | 117 | Putative regulator protein YcfX {Salmonella typhim | 93.64 | |
| d1q18a1 | 110 | Glucokinase Glk {Escherichia coli [TaxId: 562]} | 92.7 | |
| d2aa4a1 | 119 | N-acetylmannosamine kinase NanK {Escherichia coli | 92.42 | |
| d1woqa1 | 129 | Inorganic polyphosphate/ATP-glucomannokinase PPGMK | 91.88 | |
| d3bexa1 | 118 | Type III pantothenate kinase, CoaX {Thermotoga mar | 91.64 | |
| d1xc3a1 | 118 | Putative fructokinase YhdR {Bacillus subtilis [Tax | 90.67 | |
| d2gupa1 | 114 | Hypothetical protein SP2142 {Streptococcus pneumon | 89.57 | |
| d2fsja2 | 164 | Hypothetical protein Ta0583 {Archaeon Thermoplasma | 88.59 | |
| d2f9wa2 | 114 | Type III pantothenate kinase, CoaX {Pseudomonas ae | 88.59 | |
| d2zgya1 | 157 | Plasmid segregation protein ParM {Escherichia coli | 86.81 | |
| d2fxua1 | 140 | Actin {Cow (Bos taurus) [TaxId: 9913]} | 86.8 | |
| d1sz2a1 | 319 | Glucokinase Glk {Escherichia coli [TaxId: 562]} | 83.47 | |
| d2hoea3 | 128 | N-acetylglucosamine kinase {Thermotoga maritima [T | 83.38 |
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.84 E-value=1e-21 Score=119.29 Aligned_cols=62 Identities=29% Similarity=0.351 Sum_probs=59.0
Q ss_pred CeeecCCccEEEEEEcCCCceEEEeCCCCCCccceEEEecCCceEEchhHHhhhhcCCCCccC
Q psy4514 1 MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGNSGTDICDKLIGCWTPVITQG 63 (64)
Q Consensus 1 iGIDlGt~~s~va~~~~g~~~~iv~n~~g~r~tpS~V~f~~~~r~vG~~Ak~~~~~nP~nt~~ 63 (64)
||||||||||+||++++| ++++++|++|+|++||+|+|.++++++|+.|+.++..||++++.
T Consensus 4 vGIDfGTt~s~va~~~~g-~~~ii~~~~~~r~~Ps~i~~~~~~~~vG~~a~~~~~~~p~~~i~ 65 (185)
T d1bupa1 4 VGIDLGSTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVF 65 (185)
T ss_dssp EEEEECSSEEEEEEEETT-EEEECCCTTSCSSEECCEEECSSCEEETHHHHTTTTTCGGGEEC
T ss_pred EEEEcChhcEEEEEEECC-EEEEEECCCCCccceeEEEECCCcEEEeechHHHhhcCcccchh
Confidence 699999999999999999 89999999999999999999999999999999999999998863
|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} | Back information, alignment and structure |
|---|
| >d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} | Back information, alignment and structure |
|---|
| >d3bexa1 c.55.1.13 (A:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2f9wa2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2zgya1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|