Diaphorina citri psyllid: psy454


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MKEINRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH
ccccccCECccccCCcccccEEEEEEEEccccccEEEEEEEEccccccccccccCEEEEEEEEECccccccEEEEECcccccccccccccccccccccccccCEEEcEEEcccccCEEEccEEEEEEEEEEccc
***INRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEINRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009898 [CC]internal side of plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0032147 [BP]activation of protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0045860, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0035631 [CC]CD40 receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CA9, chain A
Confidence level:very confident
Coverage over the Query: 7-132
View the alignment between query and template
View the model in PyMOL