Psyllid ID: psy454

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MKEINRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH
ccccccEEEccccEEcccccEEEEEEEEccccccEEEEEEEEccccccccccccEEEEEEEEEEEccccccEEEEEEcccccccccccccccccccccccccEEEEcEEEcccccEEEEccEEEEEEEEEEccc
ccccccccccccccccccccEEEEEEEEccccccEEEEEEEEEccccHHHcccccccEEEEEEccccccccHHHcccccccccccccccccccccccccccccccHHHHHccccccEEEccEEEEEEEEEcccc
mkeinryfysacfysscfgyrfctrvnisrEDAQYLSLFIHLVqgenddildwpfvgrirftalntssefsitdeiqsdknfdsfkrpvnfflnkkafgfnnfIRVAdvldpgrgflmeddTFVIKTQVTEMTH
MKEINRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTAlntssefsitdeiqsdknfDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH
MKEINRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH
***INRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKT*******
*****RY*YSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFS***********************KKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH
MKEINRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH
***INRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEM**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEINRYFYSACFYSSCFGYRFCTRVNISREDAQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMTH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query134 2.2.26 [Sep-21-2011]
P70196530 TNF receptor-associated f yes N/A 0.880 0.222 0.333 2e-12
B5DF45530 TNF receptor-associated f yes N/A 0.880 0.222 0.333 3e-12
Q3ZCC3542 TNF receptor-associated f yes N/A 0.873 0.215 0.353 4e-12
A7XUJ6541 TNF receptor-associated f yes N/A 0.873 0.216 0.376 5e-12
Q28DL4558 TNF receptor-associated f yes N/A 0.895 0.215 0.315 5e-12
B6CJY5522 TNF receptor-associated f yes N/A 0.873 0.224 0.353 6e-12
B6CJY4522 TNF receptor-associated f N/A N/A 0.873 0.224 0.353 6e-12
Q9Y4K3522 TNF receptor-associated f yes N/A 0.873 0.224 0.353 9e-12
Q6IWL4542 TNF receptor-associated f yes N/A 0.888 0.219 0.299 2e-11
Q6DJN2556 TNF receptor-associated f N/A N/A 0.843 0.203 0.325 2e-11
>sp|P70196|TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus GN=Traf6 PE=1 SV=2 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 11/129 (8%)

Query: 9   YSACFYSSCFGYRFCTRVNISREDAQ----YLSLFIHLVQGENDDILDWPFVGRIRFTAL 64
           +S  FY+   GY+ C R+++    AQ    Y+SLF+H +QGE D  L WPF G IR T L
Sbjct: 384 HSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 443

Query: 65  NTSSEF--SITDEIQSDK-NFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDD 121
           + S        +E+   K    +F+RP     N K FG+  F+ +  +    +G  ++DD
Sbjct: 444 DQSEALIRQNHEEVMDAKPELLAFQRP-TIPRNPKGFGYVTFMHLEALR---QGTFIKDD 499

Query: 122 TFVIKTQVT 130
           T +++ +V+
Sbjct: 500 TLLVRCEVS 508
E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, AKT1 and AKT2. Also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation (By similarity). Leads to the activation of NF-kappa-B and JUN. May be essential for the formation of functional osteoclasts. Seems to also play a role in dendritic cells (DCs) maturation and/or activation. Represses c-Myb-mediated transactivation, in B-lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor. Regulates osteoclast differentiation by mediating the activation of adapter protein complex 1 (AP-1) and NF-kappa-B, in response to RANK-L stimulation.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|B5DF45|TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus GN=Traf6 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZCC3|TRAF6_BOVIN TNF receptor-associated factor 6 OS=Bos taurus GN=TRAF6 PE=2 SV=1 Back     alignment and function description
>sp|A7XUJ6|TRAF6_PIG TNF receptor-associated factor 6 OS=Sus scrofa GN=TRAF6 PE=2 SV=1 Back     alignment and function description
>sp|Q28DL4|TRAF6_XENTR TNF receptor-associated factor 6 OS=Xenopus tropicalis GN=traf6 PE=2 SV=1 Back     alignment and function description
>sp|B6CJY5|TRAF6_MACMU TNF receptor-associated factor 6 OS=Macaca mulatta GN=TRAF6 PE=2 SV=1 Back     alignment and function description
>sp|B6CJY4|TRAF6_CERAT TNF receptor-associated factor 6 OS=Cercocebus atys GN=TRAF6 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4K3|TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens GN=TRAF6 PE=1 SV=1 Back     alignment and function description
>sp|Q6IWL4|TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio GN=traf6 PE=2 SV=2 Back     alignment and function description
>sp|Q6DJN2|TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis GN=traf6-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
304360632 594 tumor necrosis factor receptor-associate 0.947 0.213 0.416 5e-22
307193327 370 TNF receptor-associated factor 6 [Harpeg 0.880 0.318 0.384 4e-19
242007226 411 conserved hypothetical protein [Pediculu 0.910 0.296 0.409 5e-19
383862215 416 PREDICTED: TNF receptor-associated facto 0.917 0.295 0.361 5e-19
380013177 399 PREDICTED: TNF receptor-associated facto 0.880 0.295 0.368 1e-18
328782285 422 PREDICTED: TNF receptor-associated facto 0.880 0.279 0.368 2e-18
332021684 358 TNF receptor-associated factor 6 [Acromy 0.917 0.343 0.369 8e-18
340712675 413 PREDICTED: TNF receptor-associated facto 0.880 0.285 0.368 1e-17
350418145 414 PREDICTED: TNF receptor-associated facto 0.880 0.285 0.368 1e-17
379698888 359 TRAF6 [Bombyx mori] gi|304421474|gb|ADM3 0.932 0.348 0.353 3e-17
>gi|304360632|gb|ADM26237.1| tumor necrosis factor receptor-associated factor 6 [Litopenaeus vannamei] Back     alignment and taxonomy information
 Score =  108 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 55/132 (41%), Positives = 76/132 (57%), Gaps = 5/132 (3%)

Query: 6   RYFYSACFYSSCFGYRFCTRVNISREDAQY-LSLFIHLVQGENDDILDWPFVGRIRFTAL 64
           R  +S  FY+S FGY+FC R NI+ +  QY L+LFIH +Q ENDD LDWPF GRI  + L
Sbjct: 437 RVCHSPSFYTSQFGYKFCLRTNITWKSEQYFLTLFIHGMQSENDDFLDWPFSGRITLSVL 496

Query: 65  NTSSEFS---ITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDD 121
           +         IT+ + +     +FKRP +   N K FGF  F+ +A +L P  G  +++D
Sbjct: 497 DCDISLPKNHITETMVTKPGLQAFKRP-DVARNPKGFGFTEFVPLAKILQPSTGTFLKND 555

Query: 122 TFVIKTQVTEMT 133
           T  I+  V   T
Sbjct: 556 TLCIRATVCPNT 567

Source: Litopenaeus vannamei

Species: Litopenaeus vannamei

Genus: Litopenaeus

Family: Penaeidae

Order: Decapoda

Class: Malacostraca

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307193327|gb|EFN76189.1| TNF receptor-associated factor 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242007226|ref|XP_002424443.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507843|gb|EEB11705.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383862215|ref|XP_003706579.1| PREDICTED: TNF receptor-associated factor 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380013177|ref|XP_003690643.1| PREDICTED: TNF receptor-associated factor 6-B-like [Apis florea] Back     alignment and taxonomy information
>gi|328782285|ref|XP_624207.3| PREDICTED: TNF receptor-associated factor 6 [Apis mellifera] Back     alignment and taxonomy information
>gi|332021684|gb|EGI62040.1| TNF receptor-associated factor 6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340712675|ref|XP_003394881.1| PREDICTED: TNF receptor-associated factor 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350418145|ref|XP_003491757.1| PREDICTED: TNF receptor-associated factor 6-A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|379698888|ref|NP_001243915.1| TRAF6 [Bombyx mori] gi|304421474|gb|ADM32536.1| TRAF6 [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
UNIPROTKB|A7XUJ6541 TRAF6 "TNF receptor-associated 0.873 0.216 0.376 2.5e-12
UNIPROTKB|Q3ZCC3542 TRAF6 "TNF receptor-associated 0.873 0.215 0.353 4e-12
MGI|MGI:108072530 Traf6 "TNF receptor-associated 0.880 0.222 0.341 5e-12
RGD|1306853530 Traf6 "TNF receptor-associated 0.873 0.220 0.353 5e-12
UNIPROTKB|B6CJY4522 TRAF6 "TNF receptor-associated 0.873 0.224 0.353 6.2e-12
UNIPROTKB|B6CJY5522 TRAF6 "TNF receptor-associated 0.873 0.224 0.353 6.2e-12
UNIPROTKB|Q9Y4K3522 TRAF6 "TNF receptor-associated 0.873 0.224 0.353 8e-12
UNIPROTKB|Q28DL4558 traf6 "TNF receptor-associated 0.895 0.215 0.330 9e-12
UNIPROTKB|E1C626548 TRAF6 "Uncharacterized protein 0.873 0.213 0.343 1.1e-11
UNIPROTKB|F5H1P7451 TRAF5 "TNF receptor-associated 0.880 0.261 0.330 1.6e-11
UNIPROTKB|A7XUJ6 TRAF6 "TNF receptor-associated factor 6" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 174 (66.3 bits), Expect = 2.5e-12, P = 2.5e-12
 Identities = 49/130 (37%), Positives = 72/130 (55%)

Query:     9 YSACFYSSCFGYRFCTRVNISREDAQ----YLSLFIHLVQGENDDILDWPFVGRIRFTAL 64
             +S  FY+   GY+ C R+++    AQ    Y+SLF+H +QGE D  L WPF G IR T L
Sbjct:   395 HSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 454

Query:    65 NTSSEFSIT---DEIQSDK-NFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMED 120
             +  SE  I    +EI   K    +F+RP     N K FG+  F+ + D L   R F+ +D
Sbjct:   455 D-QSEAPIRQNHEEIMDAKPELLAFQRPT-IPRNPKGFGYVTFMHL-DALRQ-RTFI-KD 509

Query:   121 DTFVIKTQVT 130
             DT +++ +V+
Sbjct:   510 DTLLVRCEVS 519
GO:0005811 "lipid particle" evidence=ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0070534 "protein K63-linked ubiquitination" evidence=ISS
GO:0005938 "cell cortex" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0070498 "interleukin-1-mediated signaling pathway" evidence=IEA
GO:0051865 "protein autoubiquitination" evidence=IEA
GO:0050852 "T cell receptor signaling pathway" evidence=IEA
GO:0048468 "cell development" evidence=IEA
GO:0046849 "bone remodeling" evidence=IEA
GO:0045672 "positive regulation of osteoclast differentiation" evidence=IEA
GO:0043507 "positive regulation of JUN kinase activity" evidence=IEA
GO:0043123 "positive regulation of I-kappaB kinase/NF-kappaB cascade" evidence=IEA
GO:0042981 "regulation of apoptotic process" evidence=IEA
GO:0031666 "positive regulation of lipopolysaccharide-mediated signaling pathway" evidence=IEA
GO:0009887 "organ morphogenesis" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0007250 "activation of NF-kappaB-inducing kinase activity" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0001503 "ossification" evidence=IEA
UNIPROTKB|Q3ZCC3 TRAF6 "TNF receptor-associated factor 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:108072 Traf6 "TNF receptor-associated factor 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306853 Traf6 "TNF receptor-associated factor 6, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B6CJY4 TRAF6 "TNF receptor-associated factor 6" [Cercocebus atys (taxid:9531)] Back     alignment and assigned GO terms
UNIPROTKB|B6CJY5 TRAF6 "TNF receptor-associated factor 6" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4K3 TRAF6 "TNF receptor-associated factor 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q28DL4 traf6 "TNF receptor-associated factor 6" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|E1C626 TRAF6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F5H1P7 TRAF5 "TNF receptor-associated factor 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
cd03776147 cd03776, MATH_TRAF6, Tumor Necrosis Factor Recepto 5e-35
cd00270149 cd00270, MATH_TRAF_C, Tumor Necrosis Factor Recept 3e-27
cd03778164 cd03778, MATH_TRAF2, Tumor Necrosis Factor Recepto 2e-12
cd03779147 cd03779, MATH_TRAF1, Tumor Necrosis Factor Recepto 1e-11
cd03780148 cd03780, MATH_TRAF5, Tumor Necrosis Factor Recepto 6e-11
cd03781154 cd03781, MATH_TRAF4, Tumor Necrosis Factor Recepto 4e-10
cd03777186 cd03777, MATH_TRAF3, Tumor Necrosis Factor Recepto 4e-10
cd00121126 cd00121, MATH, MATH (meprin and TRAF-C homology) d 9e-10
cd03771167 cd03771, MATH_Meprin, Meprin family, MATH domain; 3e-07
pfam00917116 pfam00917, MATH, MATH domain 2e-06
cd03774139 cd03774, MATH_SPOP, Speckle-type POZ protein (SPOP 7e-06
cd03783167 cd03783, MATH_Meprin_Alpha, Meprin family, Alpha s 1e-05
cd03782167 cd03782, MATH_Meprin_Beta, Meprin family, Beta sub 5e-05
>gnl|CDD|239745 cd03776, MATH_TRAF6, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 Back     alignment and domain information 
 Score =  117 bits (296), Expect = 5e-35
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 8/127 (6%)

Query: 8   FYSACFYSSCFGYRFCTRVNISR---EDAQYLSLFIHLVQGENDDILDWPFVGRIRFTAL 64
            +S  FY+S  GY+ C R+N+S        Y+SLF+HL+QGEND  LDWPF G I  T L
Sbjct: 25  IHSPGFYTSPPGYKLCARLNLSLPEARCPNYISLFVHLMQGENDSHLDWPFQGTITLTLL 84

Query: 65  NTSSEF-SITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTF 123
           + S    +I + + S     +F+RP     N K FG+  F  + D+L   RGF+ ++DT 
Sbjct: 85  DQSEPRQNIHETMMSKPELLAFQRPTT-DRNPKGFGYVEFAHIEDLLQ--RGFV-KNDTL 140

Query: 124 VIKTQVT 130
           +IK +V 
Sbjct: 141 LIKIEVN 147

TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses. TRAF6 is the most divergent in its TRAF domain among the mammalian TRAFs. In addition to mediating TNFR family signaling, it is also an essential signaling molecule of the interleukin-1/Toll-like receptor superfamily. Whereas other TRAF molecules display similar and overlapping TNFR-binding specificities, TRAF6 binds completely different sites on receptors such as CD40 and RANK. TRAF6 serves as a molecular bridge between innate and adaptive immunity and plays a central role in osteoimmunology. DTRAF2, as an activator of nuclear factor-kappaB, plays a pivotal role in Drosophila development and innate immunity. TRAF6 contains a RING finger domain, five zinc finger domains, and a TRAF domain. The TRAF domain can be divided into a more divergent N-terminal alpha helical region (TRAF-N), and a highly conserved C-terminal MATH subdomain (TRAF-C) with an eight-stranded beta-sandwich structure. TRAF-N mediates trimerization while TRAF-C interacts with receptors. Length = 147
>gnl|CDD|238168 cd00270, MATH_TRAF_C, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems Back     alignment and domain information
>gnl|CDD|239747 cd03778, MATH_TRAF2, Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>gnl|CDD|239748 cd03779, MATH_TRAF1, Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>gnl|CDD|239749 cd03780, MATH_TRAF5, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>gnl|CDD|239750 cd03781, MATH_TRAF4, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 Back     alignment and domain information
>gnl|CDD|239746 cd03777, MATH_TRAF3, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>gnl|CDD|238068 cd00121, MATH, MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins Back     alignment and domain information
>gnl|CDD|239740 cd03771, MATH_Meprin, Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces Back     alignment and domain information
>gnl|CDD|216189 pfam00917, MATH, MATH domain Back     alignment and domain information
>gnl|CDD|239743 cd03774, MATH_SPOP, Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP Back     alignment and domain information
>gnl|CDD|239752 cd03783, MATH_Meprin_Alpha, Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides Back     alignment and domain information
>gnl|CDD|239751 cd03782, MATH_Meprin_Beta, Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 134
cd03778164 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) A 100.0
cd03780148 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-A 100.0
cd03779147 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) A 100.0
cd03777186 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-A 100.0
cd03771167 MATH_Meprin Meprin family, MATH domain; Meprins ar 100.0
cd03783167 MATH_Meprin_Alpha Meprin family, Alpha subunit, MA 100.0
cd03782167 MATH_Meprin_Beta Meprin family, Beta subunit, MATH 100.0
cd03776147 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-A 100.0
cd03781154 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-A 100.0
cd00270149 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)- 100.0
cd03773132 MATH_TRIM37 Tripartite motif containing protein 37 99.92
cd03774139 MATH_SPOP Speckle-type POZ protein (SPOP) family, 99.92
cd03775134 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p 99.92
cd03772137 MATH_HAUSP Herpesvirus-associated ubiquitin-specif 99.9
cd00121126 MATH MATH (meprin and TRAF-C homology) domain; an 99.86
PF00917119 MATH: MATH domain; InterPro: IPR002083 Although ap 99.83
smart0006195 MATH meprin and TRAF homology. 99.64
KOG0297|consensus391 99.49
COG5077 1089 Ubiquitin carboxyl-terminal hydrolase [Posttransla 99.01
KOG1987|consensus 297 98.01
KOG1863|consensus 1093 97.26
>cd03778 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information 
Probab=100.00  E-value=4.2e-39  Score=226.42  Aligned_cols=122  Identities=31%  Similarity=0.602  Sum_probs=111.8

Q ss_pred             CceEEecceEeCCCCeEEEEEEEECCCC---CCcEEEEEEEecCCCCCCCCCccceEEEEEEEeCCCCCeeeEEeecCCC
Q psy454            5 NRYFYSACFYSSCFGYRFCTRVNISRED---AQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKN   81 (134)
Q Consensus         5 ~~~~~S~~F~~~~~Gy~w~l~vyp~g~~---~~~lsv~l~l~~g~~D~~l~Wp~~~~~~l~lldq~~~~~~~~~~~~~~~   81 (134)
                      ...++||+||++.+||+|+|++||||.+   ++|||||++|++|++|+.|+|||..+++|+||||.+++|+..++.|+++
T Consensus        40 ~~~i~Sp~Fyt~~~GYk~~l~~ylnG~g~~~g~~LSly~~l~~Ge~D~~L~WPf~~~itl~llDQ~~r~hi~~~~~pd~~  119 (164)
T cd03778          40 IPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVT  119 (164)
T ss_pred             CceEECCCcccCCCCeEEEEEEEeCCCCCCCCCEEEEEEEEecCCcCcccCCceeeEEEEEEECCCCCCcceeEEEcCcc
Confidence            3589999999999999999999999987   7799999999999999999999999999999999988899999999988


Q ss_pred             CCccCCCcccccccccccccceeecccccCCCCCCCccCCeEEEEEEEE
Q psy454           82 FDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVT  130 (134)
Q Consensus        82 ~~~f~~p~~~~~~~~~~G~~~fi~~~~L~~~~~~~yl~~d~l~i~~~v~  130 (134)
                      ..+|+||..+ .| .+||++.||++++| ++ .++||+||+|+|+|.|.
T Consensus       120 ~~~f~RP~~~-~n-~~~G~~~Fv~l~~l-~~-~~~Yv~dDtlfIk~~Vd  164 (164)
T cd03778         120 SSSFQRPVND-MN-IASGCPLFCPVSKX-EA-KNSYVRDDAIFIKAIVD  164 (164)
T ss_pred             hHhcCCCCcc-cc-cCcCcceEEEhhHc-cc-cCCcccCCeEEEEEEEC
Confidence            8899999876 55 57999999999999 54 26999999999999884

TRAF2 associates with the receptors TNFR-1, TNFR-2, RANK (which mediates differentiation and maturation of osteoclasts) and CD40 (which is important for the proliferation and activation of B cells), among others. It regulates distinct pathways that lead to the activation of nuclear factor-kappaB and Jun NH2-terminal kinases. TRAF2 also indirectly associates with death receptors through its interaction with TRADD (TNFR-associated death domain protein). It is involved in regulating oxidative stress or ROS-induced cell death and in the preconditioning of cells by sublethal stress for protection from subsequent injury. TRAF2 contains a RING finger domain, five z
>cd03780 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03779 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03777 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces Back     alignment and domain information
>cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides Back     alignment and domain information
>cd03782 MATH_Meprin_Beta Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides Back     alignment and domain information
>cd03776 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 Back     alignment and domain information
>cd03781 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 Back     alignment and domain information
>cd00270 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems Back     alignment and domain information
>cd03773 MATH_TRIM37 Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins Back     alignment and domain information
>cd03774 MATH_SPOP Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP Back     alignment and domain information
>cd03775 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast Back     alignment and domain information
>cd03772 MATH_HAUSP Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway Back     alignment and domain information
>cd00121 MATH MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins Back     alignment and domain information
>PF00917 MATH: MATH domain; InterPro: IPR002083 Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [] Back     alignment and domain information
>smart00061 MATH meprin and TRAF homology Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>KOG1863|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
1lb4_A159 Traf6 Apo Structure Length = 159 8e-14
1lb5_A160 Traf6-Rank Complex Length = 160 8e-14
4ghu_A198 Crystal Structure Of Traf3CARDIF Length = 198 2e-10
1rf3_A200 Structurally Distinct Recognition Motifs In Lymphot 2e-10
1kzz_A192 Downstream Regulator Tank Binds To The Cd40 Recogni 2e-10
1flk_A228 Molecular Basis For Cd40 Signaling Mediated By Traf 3e-10
1czz_A187 Structure Of Tnf Receptor Associated Factor 2 In Co 3e-10
1ca4_A168 Structure Of Tnf Receptor Associated Factor 2 (Traf 3e-10
1czy_A168 Crystal Structure Of The Complex Between The Traf D 3e-10
1ca9_A192 Structure Of Tnf Receptor Associated Factor 2 In Co 3e-10
1f3v_B171 Crystal Structure Of The Complex Between The N-Term 1e-09
1qsc_A191 Crystal Structure Of The Traf Domain Of Traf2 In A 1e-09
4gjh_A178 Crystal Structure Of The Traf Domain Of Traf5 Lengt 2e-09
>pdb|1LB4|A Chain A, Traf6 Apo Structure Length = 159 Back     alignment and structure 
Iteration: 1

 Score = 72.0 bits (175), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 71/131 (54%), Gaps = 13/131 (9%)
Query: 8   FYSACFYSSCFGYRFCTRVNISREDAQ----YLSLFIHLVQGENDDILDWPFVGRIRFTA 63
            +S  FY+   GY+ C R+++    AQ    Y+SLF+H +QGE D  L WPF G IR T 
Sbjct: 28  IHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTI 87
Query: 64  LNTSSEFSIT---DEIQSDK-NFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLME 119
           L+  SE  +    +EI   K    +F+RP     N K FG+  F+ +  +    R F+ +
Sbjct: 88  LD-QSEAPVRQNHEEIMDAKPELLAFQRP-TIPRNPKGFGYVTFMHLEALRQ--RTFI-K 142
Query: 120 DDTFVIKTQVT 130
           DDT +++ +V+
Sbjct: 143 DDTLLVRCEVS 153
>pdb|1LB5|A Chain A, Traf6-Rank Complex Length = 160 Back     alignment and structure
>pdb|4GHU|A Chain A, Crystal Structure Of Traf3CARDIF Length = 198 Back     alignment and structure
>pdb|1RF3|A Chain A, Structurally Distinct Recognition Motifs In Lymphotoxin-B Receptor And Cd40 For Traf-Mediated Signaling Length = 200 Back     alignment and structure
>pdb|1KZZ|A Chain A, Downstream Regulator Tank Binds To The Cd40 Recognition Site On Traf3 Length = 192 Back     alignment and structure
>pdb|1FLK|A Chain A, Molecular Basis For Cd40 Signaling Mediated By Traf3 Length = 228 Back     alignment and structure
>pdb|1CZZ|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex With A 17-Residue Cd40 Peptide Length = 187 Back     alignment and structure
>pdb|1CA4|A Chain A, Structure Of Tnf Receptor Associated Factor 2 (Traf2) Length = 168 Back     alignment and structure
>pdb|1CZY|A Chain A, Crystal Structure Of The Complex Between The Traf Domain Of Human Traf2 And An Lmp1 Binding Peptide Length = 168 Back     alignment and structure
>pdb|1CA9|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex With A Peptide From Tnf-R2 Length = 192 Back     alignment and structure
>pdb|1F3V|B Chain B, Crystal Structure Of The Complex Between The N-Terminal Domain Of Tradd And The Traf Domain Of Traf2 Length = 171 Back     alignment and structure
>pdb|1QSC|A Chain A, Crystal Structure Of The Traf Domain Of Traf2 In A Complex With A Peptide From The Cd40 Receptor Length = 191 Back     alignment and structure
>pdb|4GJH|A Chain A, Crystal Structure Of The Traf Domain Of Traf5 Length = 178 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
1ca9_A192 TRAF2, protein (TNF receptor associated factor 2); 2e-25
1lb6_A160 TNF receptor-associated factor 6; TRAF6-CD40 compl 2e-24
1d00_A168 Tumor necrosis factor receptor associated protein 2e-24
2gkw_A192 TNF receptor-associated factor 3; CD40, NF-KB sign 7e-24
1flk_A228 TNF receptor associated factor 3; TNF signaling, T 2e-23
3ivv_A145 Speckle-type POZ protein; protein binding, nucleus 2e-09
2foj_A155 Ubiquitin carboxyl-terminal hydrolase 7; MATH doma 5e-09
3hqi_A 312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 4e-04
>1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Length = 192 Back     alignment and structure
 Score = 94.3 bits (234), Expect = 2e-25
 Identities = 38/137 (27%), Positives = 65/137 (47%), Gaps = 8/137 (5%)

Query: 1   MKEINRYFYSACFYSSCFGYRFCTRVNI---SREDAQYLSLFIHLVQGENDDILDWPFVG 57
           +       +S  FY+S +GY+ C R+ +         +LSLF  +++G ND +L WPF  
Sbjct: 60  VAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQ 119

Query: 58  RIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFL 117
           ++    L+ ++   + D  + D    SF+RPVN      A G   F  V+  ++    ++
Sbjct: 120 KVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVND--MNIASGCPLFCPVSK-MEAKNSYV 176

Query: 118 MEDDTFVIKTQVTEMTH 134
             DD   IK  V ++T 
Sbjct: 177 -RDDAIFIKAIV-DLTG 191
>1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Length = 160 Back     alignment and structure
>1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Length = 168 Back     alignment and structure
>2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Length = 192 Back     alignment and structure
>1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Length = 228 Back     alignment and structure
>3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Length = 145 Back     alignment and structure
>2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
1lb6_A160 TNF receptor-associated factor 6; TRAF6-CD40 compl 100.0
4ghu_A198 TNF receptor-associated factor 3; alpha/beta, inna 100.0
2gkw_A192 TNF receptor-associated factor 3; CD40, NF-KB sign 100.0
4gjh_A178 TNF receptor-associated factor 5; TRAF domain, imm 100.0
1flk_A228 TNF receptor associated factor 3; TNF signaling, T 100.0
1d00_A168 Tumor necrosis factor receptor associated protein 100.0
1ca9_A192 TRAF2, protein (TNF receptor associated factor 2); 100.0
4gwm_A592 Meprin A subunit beta; mulidomain structure, hydro 99.95
3ivv_A145 Speckle-type POZ protein; protein binding, nucleus 99.95
2foj_A155 Ubiquitin carboxyl-terminal hydrolase 7; MATH doma 99.93
3hqi_A 312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.88
2f1z_A 522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 99.81
>1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Back     alignment and structure
Probab=100.00  E-value=4.6e-35  Score=204.84  Aligned_cols=123  Identities=32%  Similarity=0.625  Sum_probs=104.9

Q ss_pred             eEEecceEeCCCCeEEEEEEEECCCC----CCcEEEEEEEecCCCCCCCCCccceEEEEEEEeCCCC---CeeeEEeecC
Q psy454            7 YFYSACFYSSCFGYRFCTRVNISRED----AQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSE---FSITDEIQSD   79 (134)
Q Consensus         7 ~~~S~~F~~~~~Gy~w~l~vyp~g~~----~~~lsv~l~l~~g~~D~~l~Wp~~~~~~l~lldq~~~---~~~~~~~~~~   79 (134)
                      .++||+|+++..||+|+|++||||.+    ++|||+||+|++|++|+.|+||++++++|+|+||.+.   +++.+++.++
T Consensus        28 ~i~S~~F~vg~~Gy~w~i~~yP~G~~~~~~~~~lSlyL~l~~~~~d~~l~wp~~a~~~l~lldq~~~~~~~~~~~~~~~~  107 (160)
T 1lb6_A           28 VIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAK  107 (160)
T ss_dssp             EEECCCEESSSSCCEEEEEEEECCTTCTTTTTEEEEEEEEECCTTGGGSCSSCCSEEEEEECCCSCTTSCCCEEEEEECC
T ss_pred             EEECcCeecCCCCeeEEEEEEecCCCCCCCCCEEEEEEEEeecCCCccCCCceeeeEEEEEEcCCCccccccceEEeecC
Confidence            89999999933399999999999964    5799999999999999999999999999999999843   3556667667


Q ss_pred             CCCCccCCCcccccccccccccceeecccccCCCCCCCccCCeEEEEEEEEecc
Q psy454           80 KNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMT  133 (134)
Q Consensus        80 ~~~~~f~~p~~~~~~~~~~G~~~fi~~~~L~~~~~~~yl~~d~l~i~~~v~~~~  133 (134)
                      ++...|.+|... .+..+|||++||++++| ++  +|||+||+|+|+|+|+++.
T Consensus       108 ~~~~~f~~p~~~-~~~~~~G~~~Fi~~~~L-~~--~~yl~dD~l~I~~~V~v~~  157 (160)
T 1lb6_A          108 PELLAFQRPTIP-RNPKGFGYVTFMHLEAL-RQ--RTFIKDDTLLVRCEVSTRF  157 (160)
T ss_dssp             TTSGGGSCCSSS-BCSEEEEEEEEEEGGGG-GT--SCCCBTTBEEEEEEEEC--
T ss_pred             CcchhccCCccc-CCCCCcCEeeEeEHHHh-hh--CCCccCCEEEEEEEEEEee
Confidence            777789988754 34458999999999999 76  8999999999999999863
>4ghu_A TNF receptor-associated factor 3; alpha/beta, innate immunity, IFN pathway, immune system; 2.20A {Mus musculus} PDB: 2gkw_A 1kzz_A 1l0a_A 1zms_A 1rf3_A Back     alignment and structure
>2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Back     alignment and structure
>4gjh_A TNF receptor-associated factor 5; TRAF domain, immune system; 2.81A {Mus musculus} Back     alignment and structure
>1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Back     alignment and structure
>1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Back     alignment and structure
>1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure
>3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} SCOP: b.8.1.1 PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Back     alignment and structure
>2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 134
d1czya1152 b.8.1.1 (A:350-501) TNF receptor associated factor 2e-17
d1lb6a_155 b.8.1.1 (A:) TNF receptor associated factor 6 (TRA 2e-15
d1l0aa1155 b.8.1.1 (A:350-504) TNF receptor associated factor 5e-14
d2cr2a1146 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H 2e-09
>d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Length = 152 Back     information, alignment and structure

class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: MATH domain
domain: TNF receptor associated factor 2 (TRAF2)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.3 bits (174), Expect = 2e-17
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 7/132 (5%)

Query: 1   MKEINRYFYSACFYSSCFGYRFCTRVNISREDAQ---YLSLFIHLVQGENDDILDWPFVG 57
           +       +S  FY+S +GY+ C R+ ++ +      +LSLF  +++G ND +L WPF  
Sbjct: 20  VAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQ 79

Query: 58  RIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFL 117
           ++    L+ ++   + D  + D    SF+RP        A G   F  V   ++    ++
Sbjct: 80  KVTLMLLDQNNREHVIDAFRPDVTSSSFQRP--VNDMNIASGCPLFCPV-SKMEAKNSYV 136

Query: 118 MEDDTFVIKTQV 129
             DD   IK  V
Sbjct: 137 -RDDAIFIKAIV 147
>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
d1czya1152 TNF receptor associated factor 2 (TRAF2) {Human (H 100.0
d1l0aa1155 TNF receptor associated factor 3 (TRAF3) {Human (H 100.0
d1lb6a_155 TNF receptor associated factor 6 (TRAF6) {Human (H 100.0
d2cr2a1146 Speckle-type poz protein SPOP {Human (Homo sapiens 99.91
>d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: MATH domain
domain: TNF receptor associated factor 2 (TRAF2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.4e-34  Score=198.93  Aligned_cols=124  Identities=30%  Similarity=0.579  Sum_probs=106.8

Q ss_pred             CceEEecceEeCCCCeEEEEEEEECCCC---CCcEEEEEEEecCCCCCCCCCccceEEEEEEEeCCCCCeeeEEeecCCC
Q psy454            5 NRYFYSACFYSSCFGYRFCTRVNISRED---AQYLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKN   81 (134)
Q Consensus         5 ~~~~~S~~F~~~~~Gy~w~l~vyp~g~~---~~~lsv~l~l~~g~~D~~l~Wp~~~~~~l~lldq~~~~~~~~~~~~~~~   81 (134)
                      .+.++||+|+++..||+|+|++||+|.+   ++|+||||+|++|++|+.++||+.++++|+|+||.++++....+.....
T Consensus        24 ~~~~~Sp~F~~g~~Gy~w~l~~yP~G~~~~~~~~lSlyL~l~~~~~d~~~~~~~~~~~~~~l~d~~~~~~~~~~~~~~~~  103 (152)
T d1czya1          24 IPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVT  103 (152)
T ss_dssp             CCCEECCCEESSTTSCEEEEEEETTCCGGGTTTEEEEEEEEECCTTGGGSCSSCCCCEEEEECCTTSSCCEEEEECCCTT
T ss_pred             CceEECcCEEcCCCCeEEEEEEEeCCCCCCCCCEEEEEEEEccCCcCcccccceeeEEEEEEEcCCCCccceeeeccccc
Confidence            4579999999965599999999999976   7899999999999999999999999999999999977766665665555


Q ss_pred             CCccCCCcccccccccccccceeecccccCCCCCCCccCCeEEEEEEEEec
Q psy454           82 FDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEM  132 (134)
Q Consensus        82 ~~~f~~p~~~~~~~~~~G~~~fi~~~~L~~~~~~~yl~~d~l~i~~~v~~~  132 (134)
                      ...|+||... . ..+|||++||++++| ++ .+|||+||+|+|+|+|++.
T Consensus       104 ~~~~~r~~~~-~-~~~~G~~~fi~~~~L-~~-~~gfl~dD~l~I~~~V~v~  150 (152)
T d1czya1         104 SSSFQRPVND-M-NIASGCPLFCPVSKM-EA-KNSYVRDDAIFIKAIVDLT  150 (152)
T ss_dssp             SGGGSCCSSS-B-CCCEEEEEEEETCCC-CC-STTTSCSSCEEEEEEECCT
T ss_pred             cccccCCCcc-c-ccccchhhEEEHHHh-cc-cCCcEeCCEEEEEEEEEec
Confidence            5678888755 3 368999999999999 64 4699999999999999754
>d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure