Diaphorina citri psyllid: psy4586

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----

MNYDVIAYGSVCRDVKIHNLLVFFKSIYLDYVLGLGGLDALGMGSANFMELQQRMQTEMLRNPEMLRTILDNPLVQGMLNDPNSMRNLIMSNPQMQDLIERNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSSGGNPGRVKAPFRRSKRYLGPRQCARPSSSLSTPVLMNLLNRKQPLWPNAANPQQGQENRDPLPNPWNPGSNPSSPRPGNTTTGTLPANTPTMTTGQGGRFWVITDIYGPTALS

cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHccHHHHHHcccHHHHHHHHHccHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHcHHccccccccccccccHHHHcccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccc

**YDVIAYGSVCRDVKIHNLLVFFKSIYLDYVLGLGGLDALGMGSANFMEL**************LRTILDNPLVQGMLNDPN*************************************************************************************************************************************************************************************************QGGRFWVITDIYGPT***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquilin-1	Links CD47 to the cytoskeleton. Promotes the surface expression of GABA-A receptors (By similarity). Promotes the accumulation of uncleaved PSEN1 and PSEN2 by stimulating their biosynthesis. Has no effect on PSEN1 and PSEN2 degradation.	confident	Q5R684
Ubiquilin-1	Links CD47 to the cytoskeleton. Promotes the surface expression of GABA-A receptors (By similarity). Promotes the accumulation of uncleaved PSEN1 and PSEN2 by stimulating their biosynthesis. Has no effect on PSEN1 and PSEN2 degradation.	confident	Q9UMX0
Ubiquilin-1	Links CD47 to the cytoskeleton. Promotes the surface expression of GABA-A receptors. Promotes the accumulation of uncleaved PSEN1 and PSEN2 by stimulating their biosynthesis. Has no effect on PSEN1 and PSEN2 degradation.	confident	Q8R317

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0031595 [CC]	nuclear proteasome complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0000502, GO:0043227, GO:0043226, GO:0044422
GO:0031597 [CC]	cytosolic proteasome complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0000502
GO:0031593 [MF]	polyubiquitin binding	probable	GO:0003674, GO:0043130, GO:0032182, GO:0005488, GO:0005515
GO:0019900 [MF]	kinase binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0031396 [BP]	regulation of protein ubiquitination	probable	GO:0032268, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0031399, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LLV, chain A
Confidence level:probable
Coverage over the Query: 61-117
View the alignment between query and template
View the model in PyMOL

Template: 2F4M, chain B
Confidence level:probable
Coverage over the Query: 104-137
View the alignment between query and template
View the model in PyMOL