Diaphorina citri psyllid: psy4592


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MGVSLSLQVEEPFYPSSSNRKEFGTALILDGIIQCTEFDEFSYSEMIAFLPLCSHPNPKKVLIVGGGDGGVAREVLKHPSVESAYLVEIDNRVIEVSKKYLPGMAVGLSDPRLTVHVGDGFRFMSEHQQEFDVIITDSSDPVGPAESLFQASYFELMSRALRPGGIVCSQAGTLWYSLDCVGNTLQHCASVFPRLHC
cccEEEEEEccEEEcccccccccccEEEEcccEEEEcccccHHHHHcccccccccccccEEEEEcccccHHHHHHccccccCEEEEEEccHHHHHHHHHHccccccccccccEEEEEccHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHHcccccEEc
*GVSLSLQVEEPFYPSSSNRKEFGTALILDGIIQCTEFDEFSYSEMIAFLPLCSHPNPKKVLIVGGGDGGVAREVLKHPSVESAYLVEIDNRVIEVSKKYLPGMAVGLSDPRLTVHVGDGFRFMSEHQQEFDVIITDSSDPVGPAESLFQASYFELMSRALRPGGIVCSQAGTLWYSLDCVGNTLQHCASVFPRLHC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVSLSLQVEEPFYPSSSNRKEFGTALILDGIIQCTEFDEFSYSEMIAFLPLCSHPNPKKVLIVGGGDGGVAREVLKHPSVESAYLVEIDNRVIEVSKKYLPGMAVGLSDPRLTVHVGDGFRFMSEHQQEFDVIITDSSDPVGPAESLFQASYFELMSRALRPGGIVCSQAGTLWYSLDCVGNTLQHCASVFPRLHC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Spermidine synthase Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM), which serves as an aminopropyl donor.confidentB9MRW0
Spermidine synthase Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM), which serves as an aminopropyl donor.confidentQ5WB31
Spermidine synthase Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine.confidentQ64674

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0004766 [MF]spermidine synthase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0015940 [BP]pantothenate biosynthetic processprobableGO:0044238, GO:0042398, GO:0015939, GO:0019752, GO:0042364, GO:0044249, GO:0034641, GO:0006807, GO:0009108, GO:0044281, GO:0044711, GO:0044283, GO:1901566, GO:1901576, GO:0044710, GO:0051186, GO:0071704, GO:0006520, GO:0051188, GO:0006732, GO:0006082, GO:0006767, GO:0006766, GO:0008652, GO:0009987, GO:0009058, GO:0009110, GO:0008150, GO:0008152, GO:0043436, GO:1901564, GO:0043604, GO:0044271, GO:0006575, GO:0043603, GO:0046394, GO:0016053, GO:0044237
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0008295 [BP]spermidine biosynthetic processprobableGO:0006596, GO:0006595, GO:0042401, GO:0034641, GO:0006807, GO:0008216, GO:1901576, GO:0071704, GO:0009308, GO:0009309, GO:0009987, GO:0044106, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:1901564, GO:0044271, GO:0006576, GO:1901566, GO:0044249, GO:0044237, GO:0043170

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.16Spermidine synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IY9, chain A
Confidence level:very confident
Coverage over the Query: 2-196
View the alignment between query and template
View the model in PyMOL