Diaphorina citri psyllid: psy4593


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MRSYRGYPVLSARQDCTDFMSGPVKNMCGLVVSGAAGPGRVVCPAESLFQASYFELMSRALRPGGIVCSQAGTLWYSLDCVGNTLQHCASVFPRVAYGATCVPTYPSGQIGFVLGSQLLKQHANSHVPMTLS
cccccccccEEEEccHHHHHcccccccccEEEEcccccccccccccccccHHHHHHHHHHcccccEEEECcccccccHHHHHHHHHHHHccccccEEEEEEcccccccHHHHEEEccccccccccccccccc
**S*RGYPVLSARQDCTDFMSGPVKNMCGLVVSGAAGPGRVVCPAESLFQASYFELMSRALRPGGIVCSQAGTLWYSLDCVGNTLQHCASVFPRVAYGATCVPTYPSGQIGFVLGSQLLKQHANSHVP*T**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSYRGYPVLSARQDCTDFMSGPVKNMCGLVVSGAAGPGRVVCPAESLFQASYFELMSRALRPGGIVCSQAGTLWYSLDCVGNTLQHCASVFPRVAYGATCVPTYPSGQIGFVLGSQLLKQHANSHVPMTLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0004766 [MF]spermidine synthase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B2C, chain A
Confidence level:very confident
Coverage over the Query: 4-36,53-122
View the alignment between query and template
View the model in PyMOL