Diaphorina citri psyllid: psy4594

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--

MSGDDKKVRVLSYPNKPFYPSSSNRKEFGTALILDGIIQCTEFDEFSYSEMIAFLPLCSHPNPKKVLIFTVGGSTVQYSFPF

ccccCEEEEEEEccccccccEEEECcccccEEEEccEEEEEcccEEEEEEHHccccccccccccEEEEEEcccccEEEECcc

****DKKVRVLSYPNKPFYPSSSNRKEFGTALILDGIIQCTEFDEFSYSEMIAFLPLCSHPNPKKVLIFTVGGSTVQYSFPF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSGDDKKVRVLSYPNKPFYPSSSNRKEFGTALILDGIIQCTEFDEFSYSEMIAFLPLCSHPNPKKVLIFTVGGSTVQYSFPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Spermidine synthase	Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM), which serves as an aminopropyl donor.	confident	B9MRW0
Spermidine synthase	Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM), which serves as an aminopropyl donor.	confident	A5N219
Spermidine synthase	Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM), which serves as an aminopropyl donor.	confident	Q5WB31

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0004766 [MF]	spermidine synthase activity	probable	GO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015940 [BP]	pantothenate biosynthetic process	probable	GO:0044238, GO:0042398, GO:0015939, GO:0019752, GO:0042364, GO:0044249, GO:0034641, GO:0006807, GO:0009108, GO:0044281, GO:0044711, GO:0044283, GO:1901566, GO:1901576, GO:0044710, GO:0051186, GO:0071704, GO:0006520, GO:0051188, GO:0006732, GO:0006082, GO:0006767, GO:0006766, GO:0008652, GO:0009987, GO:0009058, GO:0009110, GO:0008150, GO:0008152, GO:0043436, GO:1901564, GO:0043604, GO:0044271, GO:0006575, GO:0043603, GO:0046394, GO:0016053, GO:0044237
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005576 [CC]	extracellular region	probable	GO:0005575
GO:0008295 [BP]	spermidine biosynthetic process	probable	GO:0006596, GO:0006595, GO:0042401, GO:0034641, GO:0006807, GO:0008216, GO:1901576, GO:0071704, GO:0009308, GO:0009309, GO:0009987, GO:0044106, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:1901564, GO:0044271, GO:0006576, GO:1901566, GO:0044249, GO:0044237, GO:0043170

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XJ5, chain A
Confidence level:very confident
Coverage over the Query: 7-80
View the alignment between query and template
View the model in PyMOL