Diaphorina citri psyllid: psy4596

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44

MGGIQTRVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFKQEEEMKKELVEWEKEEQEERKENLELDEVREKSTPEMPHYFQDANCVCFVNFG

ccccccccccccccccEEEEcccccccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccCEECcccccccccccccEEEEEEccccccccEEEECcccccccccccccccEEEEEEcccccHHcccccccccEEEEEccEEcccccHHHHHHHHHccccEEEEEEEccccccccEEEEEEEcccccccEEEEcccccccccccccccccEEEEEEccccccccccccccccEEEEEccEEcccccHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHccccHHHHccccccccccccccccccccccc

MGGIQ*RVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIER*************************************************************SLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKG*************DEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGF**************************************************************************HYFQDANCVCFVNFG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGGIQTRVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEMPHYFQDANCVCFVNFG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051128 [BP]	regulation of cellular component organization	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0005923 [CC]	tight junction	probable	GO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0051179 [BP]	localization	probable	GO:0008150
GO:0019220 [BP]	regulation of phosphate metabolic process	probable	GO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0044700 [BP]	single organism signaling	probable	GO:0008150, GO:0023052, GO:0044699
GO:0045211 [CC]	postsynaptic membrane	probable	GO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009966 [BP]	regulation of signal transduction	probable	GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0045169 [CC]	fusome	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071822 [BP]	protein complex subunit organization	probable	GO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0007010 [BP]	cytoskeleton organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0043209 [CC]	myelin sheath	probable	GO:0005575, GO:0044464, GO:0005623
GO:0051049 [BP]	regulation of transport	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0044422 [CC]	organelle part	probable	GO:0005575, GO:0043226
GO:0045177 [CC]	apical part of cell	probable	GO:0005575, GO:0044464, GO:0005623
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0016328 [CC]	lateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005912 [CC]	adherens junction	probable	GO:0005575, GO:0070161, GO:0030054
GO:0016327 [CC]	apicolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0031594 [CC]	neuromuscular junction	probable	GO:0005575, GO:0045202
GO:0044707 [BP]	single-multicellular organism process	probable	GO:0032501, GO:0008150, GO:0044699
GO:0051336 [BP]	regulation of hydrolase activity	probable	GO:0019222, GO:0050790, GO:0008150, GO:0065007, GO:0065009, GO:0050789
GO:0022607 [BP]	cellular component assembly	probable	GO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0042734 [CC]	presynaptic membrane	probable	GO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0007154 [BP]	cell communication	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QT5, chain A
Confidence level:very confident
Coverage over the Query: 159-350
View the alignment between query and template
View the model in PyMOL

Template: 2QT5, chain A
Confidence level:very confident
Coverage over the Query: 14-72,88,105-108,156-252
View the alignment between query and template
View the model in PyMOL

Template: 3CH8, chain A
Confidence level:probable
Coverage over the Query: 283-376
View the alignment between query and template
View the model in PyMOL

Template: 2LC6, chain A
Confidence level:probable
Coverage over the Query: 135-248
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 378-414
View the alignment between query and template
View the model in PyMOL