Psyllid ID: psy4596

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MGGIQTRVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFKQEEEMKKELVEWEKEEQEERKENLELDEVREKSTPEMPHYFQDANCVCFVNFG
ccccccccccccccccEEEEcccccccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEEcccccccccccccEEEEEEccccccccEEEEEcccccccccccccccEEEEEEcccccHHcccccccccEEEEEccEEcccccHHHHHHHHHccccEEEEEEEccccccccEEEEEEEcccccccEEEEcccccccccccccccccEEEEEEccccccccccccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHccccccccccccccccccccccc
ccccccccccccccccEEEEEcccccEEcccEEEEEcccccccccHHHHHHHHHHcccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEccccccccccccccccEEEEEEccccHHHHHccccccEEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEcHccccccEEEEEEcccccccEEEEccccccccccccHHcEEEEEEEEccccHHHHcccccccEEEEEEccEEcccccHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccHHHHHHHcccccccccccccEEEEEEcc
mggiqtrvpwtgeqAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLrysghqisltvckgfergdierrastsegsrsvtqsmssldredldtdvfkqgqwstVVTAHQrldtgyglpsnstVAAHISsslkpsilvtynffspsvrssslflqdvvlpksgplgfsiiggtdhscipfgqhkpgifishivpggvaalsgklrmgdrilavngrdvskvTHEEAVLALLEPCPEILLkiqhdphpegfQEITLIRQEGEKlgmhikgglrgqrgnpldkndegvfitkinsggaakrdgrlKVGMRLLEVNGMSLLGASHQEAVNTLrysghqisltvckgfergdierrastsegsrsvtqsmssldredldtdVFKQEEEMKKELVEWEKEEQEERKENleldevrekstpemphyfqdancvcfvnfg
mggiqtrvpwtgeQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDierrastsegsrsvtqsmssldredlDTDVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKgglrgqrgnpldkndEGVFitkinsggaakrdgrLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDierrastsegsrsvtqsmssldredldtdVFKQEEEMKKELVewekeeqeerkenleldevrekstpemphyfqdaNCVCFVNFG
MGGIQTRVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFKQeeemkkelvewekeeqeerkenleldeVREKSTPEMPHYFQDANCVCFVNFG
******RVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFE*******************************DVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHI*****************GVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFE*************************************************************************HYFQDANCVCFVN**
MGGIQ**VPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRAS**********************************************************SLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKG*************DEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVC*************************************************************************************VCFVNFG
MGGIQTRVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIER*******************REDLDTDVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIER********************EDLDTDVFKQEEEMKKELV**************ELDEVREKSTPEMPHYFQDANCVCFVNFG
*****TRVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGF************************************************************************************VRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGF***********************************************************LELDEVREKSTPEMPHYFQDANCVCFVNFG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGIQTRVPWTGEQAGVILAAGEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLDTDVFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEMPHYFQDANCVCFVNFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query439 2.2.26 [Sep-21-2011]
Q7KRY7 1851 Protein lap4 OS=Drosophil no N/A 0.451 0.106 0.708 1e-79
Q80U72 1612 Protein scribble homolog yes N/A 0.569 0.155 0.479 2e-62
Q4H4B6 1724 Protein scribble homolog yes N/A 0.546 0.139 0.481 1e-60
Q14160 1630 Protein scribble homolog yes N/A 0.553 0.149 0.484 2e-60
Q6R005 801 Disks large homolog 4 OS= no N/A 0.384 0.210 0.45 8e-29
P70175 849 Disks large homolog 3 OS= no N/A 0.451 0.233 0.411 1e-28
Q62936 849 Disks large homolog 3 OS= no N/A 0.451 0.233 0.411 1e-28
Q92796 817 Disks large homolog 3 OS= no N/A 0.384 0.206 0.444 2e-28
Q5PYH7 881 Disks large homolog 2 OS= no N/A 0.384 0.191 0.455 4e-27
Q15700 870 Disks large homolog 2 OS= no N/A 0.384 0.194 0.461 4e-27
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function desciption
 Score =  297 bits (760), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 141/199 (70%), Positives = 167/199 (83%), Gaps = 1/199 (0%)

Query: 158  LFLQDVVLPKS-GPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRI 216
            L  ++VVLPK+ G LGFSIIGGTDHSC+PFG  +PGIFISHIVPGG+A+  GKLRMGDRI
Sbjct: 1235 LISEEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRI 1294

Query: 217  LAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGG 276
            L VN  DVSK TH++AVL LL+P  EI L IQHDP P GFQE+ L + EGE+LGMHIKGG
Sbjct: 1295 LKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGG 1354

Query: 277  LRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLR 336
            L GQRGNP D +DEGVF++KINS GAA+RDGRLKVGMRLLEVNG SLLGASHQ+AVN LR
Sbjct: 1355 LNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLR 1414

Query: 337  YSGHQISLTVCKGFERGDI 355
             +G++I L VCKG+++ ++
Sbjct: 1415 NAGNEIQLVVCKGYDKSNL 1433
Required for polarization of the embryonic, imaginal disk and follicular epithelia. Specifically restricts apical membrane determinants to the apical cell surface; acts to exclude crb from the basolateral domain and define adherens junction position. Regulates cellular growth and differentiation; acts as a tumor suppressor. Essential for odor guided behavior.
Drosophila melanogaster (taxid: 7227)
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description
>sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|Q6R005|DLG4_DANRE Disks large homolog 4 OS=Danio rerio GN=dlg4 PE=2 SV=1 Back     alignment and function description
>sp|P70175|DLG3_MOUSE Disks large homolog 3 OS=Mus musculus GN=Dlg3 PE=1 SV=1 Back     alignment and function description
>sp|Q62936|DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus GN=Dlg3 PE=1 SV=1 Back     alignment and function description
>sp|Q92796|DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens GN=DLG3 PE=1 SV=2 Back     alignment and function description
>sp|Q5PYH7|DLG2_DANRE Disks large homolog 2 OS=Danio rerio GN=dlg2 PE=2 SV=1 Back     alignment and function description
>sp|Q15700|DLG2_HUMAN Disks large homolog 2 OS=Homo sapiens GN=DLG2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
380015498 2046 PREDICTED: LOW QUALITY PROTEIN: protein 0.701 0.150 0.561 1e-97
350417073 2050 PREDICTED: protein lap4-like isoform 1 [ 0.701 0.150 0.556 4e-97
350417077 1835 PREDICTED: protein lap4-like isoform 3 [ 0.701 0.167 0.556 4e-97
340713142 2051 PREDICTED: protein lap4-like isoform 3 [ 0.701 0.150 0.556 4e-97
350417075 1759 PREDICTED: protein lap4-like isoform 2 [ 0.701 0.175 0.556 4e-97
307180798 2056 Protein lap4 [Camponotus floridanus] 0.592 0.126 0.621 5e-97
340713138 1599 PREDICTED: protein lap4-like isoform 1 [ 0.701 0.192 0.550 1e-96
383856855 2047 PREDICTED: LOW QUALITY PROTEIN: protein 0.701 0.150 0.553 1e-96
332023058 2051 Protein lap4 [Acromyrmex echinatior] 0.592 0.126 0.623 1e-96
345489480 2178 PREDICTED: protein lap4-like [Nasonia vi 0.599 0.120 0.607 1e-94
>gi|380015498|ref|XP_003691738.1| PREDICTED: LOW QUALITY PROTEIN: protein lap4-like [Apis florea] Back     alignment and taxonomy information
 Score =  363 bits (931), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 236/344 (68%), Gaps = 36/344 (10%)

Query: 105  QGQWSTV-VTAHQRLDTGYGLPSNSTVAAHISSSLKPSIL-------VTYNFFSPSVRSS 156
            QG   TV +     L      P   T    ++ ++  S L       VT N   P V   
Sbjct: 1146 QGPIVTVTIKQPDNLPGDVNFPPAPTTLGKVTETITKSTLTETVVTRVTENQLVPPV--- 1202

Query: 157  SLFLQDVVLPKSGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRI 216
               ++DV+L K G LGFSIIGGTDHSC PFG  +PGIFISH+VPGG+AA SGKLRMGDRI
Sbjct: 1203 --IIEDVILVKEGSLGFSIIGGTDHSCTPFGAKEPGIFISHVVPGGIAAKSGKLRMGDRI 1260

Query: 217  LAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGG 276
            L VNG DV+K TH+EAV+ LL P  +I+L +QHDP PE +QE+ + ++ GEKLGMHIKGG
Sbjct: 1261 LKVNGTDVTKATHQEAVMELLRPGDQIVLTVQHDPLPENYQELVITKEPGEKLGMHIKGG 1320

Query: 277  LRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLR 336
            LRGQ+GNPLD  DEGVFI+KINSGGAAKRDGRLKVGMRLLEVNG SLLGA+HQEAVN LR
Sbjct: 1321 LRGQKGNPLDHTDEGVFISKINSGGAAKRDGRLKVGMRLLEVNGTSLLGATHQEAVNILR 1380

Query: 337  YSGHQISLTVCKGFERGDI-------------ERRAS-----TSEGSRSVTQSMSSLDRE 378
             SG+ I+L VCKG+++ +I             E R S     T+EG++S++QS+SSLDR+
Sbjct: 1381 CSGNTITLVVCKGYDKSEIEPVLPISDGRDSKESRTSKELKDTTEGTKSLSQSISSLDRD 1440

Query: 379  DLDTDVFKQEEEMKKELVEWEKEEQEERKENLELDEVREKSTPE 422
            D +    +QE+EMK ELV WE+EE+E       L E REKSTPE
Sbjct: 1441 DEEAATLRQEQEMKAELVAWEQEERER-----ALLEHREKSTPE 1479

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350417073|ref|XP_003491243.1| PREDICTED: protein lap4-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350417077|ref|XP_003491245.1| PREDICTED: protein lap4-like isoform 3 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713142|ref|XP_003395107.1| PREDICTED: protein lap4-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350417075|ref|XP_003491244.1| PREDICTED: protein lap4-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307180798|gb|EFN68662.1| Protein lap4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340713138|ref|XP_003395105.1| PREDICTED: protein lap4-like isoform 1 [Bombus terrestris] gi|340713140|ref|XP_003395106.1| PREDICTED: protein lap4-like isoform 2 [Bombus terrestris] gi|340713144|ref|XP_003395108.1| PREDICTED: protein lap4-like isoform 4 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383856855|ref|XP_003703922.1| PREDICTED: LOW QUALITY PROTEIN: protein lap4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332023058|gb|EGI63323.1| Protein lap4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345489480|ref|XP_001603194.2| PREDICTED: protein lap4-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
FB|FBgn0263289 1851 scrib "scribbled" [Drosophila 0.494 0.117 0.660 1.4e-75
MGI|MGI:2145950 1612 Scrib "scribbled homolog (Dros 0.564 0.153 0.473 3.5e-61
RGD|1565055 1617 Scrib "scribbled planar cell p 0.760 0.206 0.395 3.6e-61
UNIPROTKB|Q14160 1630 SCRIB "Protein scribble homolo 0.574 0.154 0.464 7.9e-61
UNIPROTKB|F1N0Y1 1611 LOC100295316 "Uncharacterized 0.496 0.135 0.506 3.2e-60
ZFIN|ZDB-GENE-030616-572 1724 scrib "scribbled homolog (Dros 0.464 0.118 0.523 5.7e-58
UNIPROTKB|E1C0D6 1526 E1C0D6 "Uncharacterized protei 0.496 0.142 0.491 6e-58
MGI|MGI:1888986 849 Dlg3 "discs, large homolog 3 ( 0.451 0.233 0.411 1.1e-30
RGD|68423 849 Dlg3 "discs, large homolog 3 ( 0.451 0.233 0.411 1.1e-30
UNIPROTKB|Q92796 817 DLG3 "Disks large homolog 3" [ 0.492 0.264 0.398 1.7e-30
FB|FBgn0263289 scrib "scribbled" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 739 (265.2 bits), Expect = 1.4e-75, Sum P(2) = 1.4e-75
 Identities = 144/218 (66%), Positives = 173/218 (79%)

Query:   158 LFLQDVVLPKS-GPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRI 216
             L  ++VVLPK+ G LGFSIIGGTDHSC+PFG  +PGIFISHIVPGG+A+  GKLRMGDRI
Sbjct:  1235 LISEEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRI 1294

Query:   217 LAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHIKGG 276
             L VN  DVSK TH++AVL LL+P  EI L IQHDP P GFQE+ L + EGE+LGMHIKGG
Sbjct:  1295 LKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGG 1354

Query:   277 LRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLR 336
             L GQRGNP D +DEGVF++KINS GAA+RDGRLKVGMRLLEVNG SLLGASHQ+AVN LR
Sbjct:  1355 LNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLR 1414

Query:   337 YSGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSS 374
              +G++I L VCKG+++ ++      + G  +   S +S
Sbjct:  1415 NAGNEIQLVVCKGYDKSNLIHSIGQAGGMSTGFNSSAS 1452
GO:0042048 "olfactory behavior" evidence=IMP
GO:0006963 "positive regulation of antibacterial peptide biosynthetic process" evidence=IMP
GO:0005918 "septate junction" evidence=NAS;IDA;TAS
GO:0016335 "morphogenesis of larval imaginal disc epithelium" evidence=IMP
GO:0016336 "establishment or maintenance of polarity of larval imaginal disc epithelium" evidence=IMP
GO:0016333 "morphogenesis of follicular epithelium" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0016327 "apicolateral plasma membrane" evidence=IDA
GO:0016328 "lateral plasma membrane" evidence=IDA
GO:0016332 "establishment or maintenance of polarity of embryonic epithelium" evidence=TAS
GO:0016331 "morphogenesis of embryonic epithelium" evidence=TAS
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IMP
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=NAS;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0007391 "dorsal closure" evidence=IMP;TAS
GO:0050803 "regulation of synapse structure and activity" evidence=IMP
GO:0007280 "pole cell migration" evidence=NAS
GO:0008406 "gonad development" evidence=NAS
GO:0008105 "asymmetric protein localization" evidence=IMP;TAS
GO:0008285 "negative regulation of cell proliferation" evidence=TAS
GO:0051726 "regulation of cell cycle" evidence=NAS
GO:0001738 "morphogenesis of a polarized epithelium" evidence=TAS
GO:0016323 "basolateral plasma membrane" evidence=IDA;TAS
GO:0035088 "establishment or maintenance of apical/basal cell polarity" evidence=IMP
GO:0019991 "septate junction assembly" evidence=IMP
GO:0045186 "zonula adherens assembly" evidence=IMP
GO:0045571 "negative regulation of imaginal disc growth" evidence=IMP
GO:0000902 "cell morphogenesis" evidence=IMP
GO:0007472 "wing disc morphogenesis" evidence=IMP
GO:0048749 "compound eye development" evidence=IMP
GO:0050680 "negative regulation of epithelial cell proliferation" evidence=IMP
GO:0045198 "establishment of epithelial cell apical/basal polarity" evidence=IMP
GO:0022402 "cell cycle process" evidence=IMP
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0030100 "regulation of endocytosis" evidence=IMP
GO:0072002 "Malpighian tubule development" evidence=IMP
GO:0001737 "establishment of imaginal disc-derived wing hair orientation" evidence=IMP
GO:0042067 "establishment of ommatidial planar polarity" evidence=IMP
GO:0007464 "R3/R4 cell fate commitment" evidence=IMP
GO:0072089 "stem cell proliferation" evidence=IMP
GO:0048863 "stem cell differentiation" evidence=IMP
GO:0045169 "fusome" evidence=IDA
MGI|MGI:2145950 Scrib "scribbled homolog (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1565055 Scrib "scribbled planar cell polarity protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q14160 SCRIB "Protein scribble homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0Y1 LOC100295316 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-572 scrib "scribbled homolog (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0D6 E1C0D6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1888986 Dlg3 "discs, large homolog 3 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|68423 Dlg3 "discs, large homolog 3 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q92796 DLG3 "Disks large homolog 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-20
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-19
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-18
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 5e-17
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 4e-14
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 9e-13
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 1e-08
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 5e-08
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-07
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 2e-07
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 8e-06
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 9e-06
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 5e-05
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 7e-05
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 0.001
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.002
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 84.9 bits (211), Expect = 2e-20
 Identities = 40/91 (43%), Positives = 50/91 (54%), Gaps = 11/91 (12%)

Query: 160 LQDVVLPK--SGPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRIL 217
           ++ V L K   G LGFS+ GG D           GIF+S + PGG A   G LR+GDRIL
Sbjct: 1   VRTVTLRKDPGGGLGFSLRGGKDS--------GGGIFVSRVEPGGPAER-GGLRVGDRIL 51

Query: 218 AVNGRDVSKVTHEEAVLALLEPCPEILLKIQ 248
            VNG  V  +THEEAV  L     E+ L ++
Sbjct: 52  EVNGVSVEGLTHEEAVELLKNSGDEVTLTVR 82

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 439
KOG3209|consensus984 100.0
KOG3209|consensus984 99.98
KOG3580|consensus 1027 99.94
KOG3580|consensus 1027 99.84
PRK10139455 serine endoprotease; Provisional 99.71
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.71
PRK10942473 serine endoprotease; Provisional 99.67
PRK10779449 zinc metallopeptidase RseP; Provisional 99.59
KOG3605|consensus829 99.54
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.52
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 99.51
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.46
PRK10942473 serine endoprotease; Provisional 99.44
PRK10139455 serine endoprotease; Provisional 99.43
PRK10779449 zinc metallopeptidase RseP; Provisional 99.39
KOG3550|consensus207 99.35
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.34
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 99.28
KOG3605|consensus829 99.26
KOG3551|consensus 506 99.09
KOG3549|consensus 505 99.08
KOG3550|consensus207 99.06
KOG3553|consensus124 99.05
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.03
KOG3553|consensus124 99.02
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.02
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.01
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.97
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.94
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.92
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.88
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.85
KOG3551|consensus 506 98.84
KOG3571|consensus 626 98.81
KOG3549|consensus 505 98.79
KOG3606|consensus358 98.78
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.76
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.75
KOG1892|consensus 1629 98.7
KOG1892|consensus 1629 98.67
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.66
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.62
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.61
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.57
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.55
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.49
KOG3651|consensus 429 98.44
KOG3606|consensus358 98.42
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.41
KOG3571|consensus626 98.41
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.4
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.35
KOG3552|consensus 1298 98.34
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.3
KOG3552|consensus 1298 98.3
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.27
KOG3651|consensus 429 98.25
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.23
PRK10898353 serine endoprotease; Provisional 98.19
KOG4371|consensus1332 98.17
PLN00049389 carboxyl-terminal processing protease; Provisional 98.15
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.15
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.15
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.12
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.12
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 98.11
KOG0609|consensus 542 98.05
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 98.04
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.0
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.95
PRK11186 667 carboxy-terminal protease; Provisional 97.92
KOG4371|consensus1332 97.92
PRK11186 667 carboxy-terminal protease; Provisional 97.91
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.9
KOG1421|consensus 955 97.9
PRK10898353 serine endoprotease; Provisional 97.87
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.84
KOG3834|consensus 462 97.82
KOG3542|consensus 1283 97.79
KOG3542|consensus 1283 97.74
KOG4407|consensus 1973 97.57
KOG0606|consensus 1205 97.56
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.43
KOG0609|consensus 542 97.42
KOG3129|consensus231 97.36
KOG1320|consensus473 97.29
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.26
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.22
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.19
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.19
KOG1421|consensus 955 97.17
KOG0606|consensus 1205 97.08
KOG3938|consensus334 96.99
COG3480342 SdrC Predicted secreted protein containing a PDZ d 96.93
KOG3129|consensus231 96.81
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.72
KOG1738|consensus 638 96.72
KOG3834|consensus 462 96.6
COG3975558 Predicted protease with the C-terminal PDZ domain 96.52
KOG3938|consensus334 96.44
PRK09681276 putative type II secretion protein GspC; Provision 96.36
PRK09681276 putative type II secretion protein GspC; Provision 96.35
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.29
COG3975558 Predicted protease with the C-terminal PDZ domain 96.23
COG3480342 SdrC Predicted secreted protein containing a PDZ d 95.91
KOG3532|consensus 1051 95.87
KOG3532|consensus 1051 95.66
COG3031275 PulC Type II secretory pathway, component PulC [In 95.07
PF1281278 PDZ_1: PDZ-like domain 94.74
KOG1320|consensus473 94.73
COG3031275 PulC Type II secretory pathway, component PulC [In 94.3
KOG1738|consensus 638 94.23
PF1281278 PDZ_1: PDZ-like domain 93.88
KOG4407|consensus 1973 91.28
COG0750375 Predicted membrane-associated Zn-dependent proteas 83.8
COG0750375 Predicted membrane-associated Zn-dependent proteas 83.15
PF11874183 DUF3394: Domain of unknown function (DUF3394); Int 80.96
PF11874183 DUF3394: Domain of unknown function (DUF3394); Int 80.13
>KOG3209|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-31  Score=262.28  Aligned_cols=292  Identities=27%  Similarity=0.376  Sum_probs=201.3

Q ss_pred             CcccccCCCCEEEEECCeecCCCCHHHHHHHHhh--cCCeEEEEEEeccccCccccccCCCCCCCCccccCCCCCcCCCc
Q psy4596          22 GEVVIHPVGMRLLEVNGMSLLGASHQEAVNTLRY--SGHQISLTVCKGFERGDIERRASTSEGSRSVTQSMSSLDREDLD   99 (439)
Q Consensus        22 ~~~~gL~~GD~Il~VNG~~v~~~~~~~~v~~l~~--~~~~v~L~V~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   99 (439)
                      -..-+|+.||.|+++|++++..++|.+++++|+.  .|..+.|+|.|++..          .++.+..    ..++.+. 
T Consensus       517 ~~c~gl~eGd~IVei~~rnvr~L~h~qvvdmlke~piG~r~~Llv~RGgp~----------s~~ktpk----~~~r~~~-  581 (984)
T KOG3209|consen  517 QDCPGLSEGDLIVEINERNVRALTHTQVVDMLKECPIGSRVHLLVKRGGPP----------SPSKTPK----AADRKEN-  581 (984)
T ss_pred             ccCCCCCCCCeEEecccccccccchHHHHHHHHhccCCcceeEEEecCCCC----------CCCcCcc----hhhhccC-
Confidence            3455799999999999999999999999999998  778999999996521          1111111    0111000 


Q ss_pred             ccccccCccceeeeccccCCCCCCCCCCCCc--ccc---------cCCCCCc-ccccccCcCCCCCCC--CCceeEEEEE
Q psy4596         100 TDVFKQGQWSTVVTAHQRLDTGYGLPSNSTV--AAH---------ISSSLKP-SILVTYNFFSPSVRS--SSLFLQDVVL  165 (439)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~---------~~~s~~~-~~~~~~~~~~~~~~~--~~~~~~~v~l  165 (439)
                           +++....... +..+...++|++..+  +.+         .+.+... +.....++..++..+  ......+|.|
T Consensus       582 -----~~s~~~s~sa-p~i~q~~Pfpp~~rs~~pd~t~~~~qrkpdp~~~we~Sraiyesr~~Ps~tsn~~pdk~ldV~L  655 (984)
T KOG3209|consen  582 -----QGSNQMSSSA-PLIPQKLPFPPTSRSEEPDNTRNTLQRKPDPTEEWEKSRAIYESRMRPSSTSNQKPDKELDVFL  655 (984)
T ss_pred             -----CCCccccccc-cccCCCCCCCCcccccCCcccccccccCCChHHHhhhcccchhccCCCCCccccCCccceeEEE
Confidence                 0110000000 001111112221000  000         0000000 111111111111100  1125667888


Q ss_pred             ecCC-CccEEEeeCCCCCCCCCCCCCCcEEEEEECCCChhhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHHhC--CCCe
Q psy4596         166 PKSG-PLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLE--PCPE  242 (439)
Q Consensus       166 ~~~~-~lG~~i~~~~~~~~~~~g~~~~g~~V~~V~~~s~A~~~G~L~~GD~Il~VNg~~v~~~~~~~~~~~l~~--~~~~  242 (439)
                      +|.. +|||.|.++.+        +..+++|..|.+.++|+..|||+.||.|+.|+|.+|.+.+|.+++.+|..  ..+.
T Consensus       656 ~rkesGFGFRiLGG~e--------p~qpi~iG~Iv~lGaAe~DGRL~~gDElv~iDG~pV~GksH~~vv~Lm~~AArngh  727 (984)
T KOG3209|consen  656 RRKESGFGFRILGGDE--------PGQPIYIGAIVPLGAAEEDGRLREGDELVCIDGIPVEGKSHSEVVDLMEAAARNGH  727 (984)
T ss_pred             EeeccccceEEecCCC--------CCCeeEEeeeeecccccccCcccCCCeEEEecCeeccCccHHHHHHHHHHHHhcCc
Confidence            8876 99999999876        34579999999999999999999999999999999999999999998874  3678


Q ss_pred             EEEEEecCCC-------------CCCcceeeeeeccCcccceeecCCccCCCCCCCCCCCCCeEEEEeCCCCchhhcCCC
Q psy4596         243 ILLKIQHDPH-------------PEGFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRL  309 (439)
Q Consensus       243 v~l~v~r~~~-------------~~~~~~v~l~~~~~~~lG~~i~~~~~~~~g~~~~~~~~gi~I~~v~~~s~A~~~G~L  309 (439)
                      |.|+|+|.-.             +.....+++.++++++|||.|.....          ..+.-|..|.+||||+++|+|
T Consensus       728 V~LtVRRkv~~~~~~rsp~~s~~~~~~yDV~lhR~ENeGFGFVi~sS~~----------kp~sgiGrIieGSPAdRCgkL  797 (984)
T KOG3209|consen  728 VNLTVRRKVRTGPARRSPRNSAAPSGPYDVVLHRKENEGFGFVIMSSQN----------KPESGIGRIIEGSPADRCGKL  797 (984)
T ss_pred             eEEEEeeeeeeccccCCcccccCCCCCeeeEEecccCCceeEEEEeccc----------CCCCCccccccCChhHhhccc
Confidence            9999987421             12235788999999999999875321          112239999999999999999


Q ss_pred             CCCCEEEEECCEEcCCCCHHHHHHHHhcCCCeEEEEEecCCcc
Q psy4596         310 KVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFER  352 (439)
Q Consensus       310 ~~GD~Il~VNg~~v~~~~~~~~~~~l~~~~~~v~l~v~r~~~~  352 (439)
                      ++||+|++|||+++.+++|.+++++||.+|-.|+|++....+.
T Consensus       798 kVGDrilAVNG~sI~~lsHadiv~LIKdaGlsVtLtIip~ee~  840 (984)
T KOG3209|consen  798 KVGDRILAVNGQSILNLSHADIVSLIKDAGLSVTLTIIPPEEA  840 (984)
T ss_pred             cccceEEEecCeeeeccCchhHHHHHHhcCceEEEEEcChhcc
Confidence            9999999999999999999999999999999999999876543

>KOG3209|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised Back     alignment and domain information
>PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 6e-27
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 1e-26
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 3e-26
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 7e-26
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 2e-24
2qt5_A200 Crystal Structure Of Grip1 Pdz12 In Complex With Th 5e-18
2qt5_A200 Crystal Structure Of Grip1 Pdz12 In Complex With Th 5e-04
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 1e-12
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 5e-09
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 5e-12
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 4e-09
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 6e-12
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 1e-09
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 1e-11
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 5e-09
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 1e-11
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 2e-07
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 1e-11
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 2e-11
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 2e-11
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 2e-08
1kef_A93 Pdz1 Of Sap90 Length = 93 2e-11
1kef_A93 Pdz1 Of Sap90 Length = 93 2e-08
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 2e-11
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 3e-08
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 3e-11
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 2e-05
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 3e-11
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 7e-06
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 4e-11
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 6e-06
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 5e-11
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 1e-05
4amh_A106 Influence Of Circular Permutation On The Folding Pa 7e-11
4amh_A106 Influence Of Circular Permutation On The Folding Pa 1e-08
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 2e-10
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 1e-05
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 3e-10
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 2e-05
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 3e-10
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 1e-07
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 3e-10
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 2e-05
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 6e-10
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 7e-10
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 7e-10
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 8e-10
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 9e-10
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 5e-06
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-09
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-08
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 1e-09
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 2e-09
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-09
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 3e-09
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 1e-09
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 2e-09
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 1e-09
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 1e-08
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 1e-09
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 2e-09
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 6e-09
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 4e-09
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 4e-08
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 4e-09
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 2e-08
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 9e-09
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 1e-08
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 1e-05
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 1e-08
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 1e-08
2jil_A97 Crystal Structure Of 2nd Pdz Domain Of Glutamate Re 1e-08
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 2e-08
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 2e-08
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 2e-08
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 2e-08
2vz5_A139 Structure Of The Pdz Domain Of Tax1 (Human T-Cell L 3e-08
2vz5_A139 Structure Of The Pdz Domain Of Tax1 (Human T-Cell L 1e-04
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 3e-08
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 4e-08
2h3l_A103 Crystal Structure Of Erbin Pdz Length = 103 4e-08
3diw_A124 C-Terminal Beta-Catenin Bound Tip-1 Structure Lengt 6e-08
3diw_A124 C-Terminal Beta-Catenin Bound Tip-1 Structure Lengt 7e-05
4e3b_A102 Crystal Structure Of Tax-Interacting Protein-1 (Tip 6e-08
4e3b_A102 Crystal Structure Of Tax-Interacting Protein-1 (Tip 1e-04
3sfj_A104 Crystal Structure Of Tax-Interacting Protein-1 (Tip 6e-08
3sfj_A104 Crystal Structure Of Tax-Interacting Protein-1 (Tip 1e-04
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 6e-08
2kg2_A124 Solution Structure Of A Pdz Protein Length = 124 6e-08
2kg2_A124 Solution Structure Of A Pdz Protein Length = 124 8e-05
3ch8_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 7e-08
2qbw_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 7e-08
1p1d_A196 Structural Insights Into The Inter-Domain Chaperoni 7e-08
3gj9_A124 Crystal Structure Of Tip-1 In Complex With C-Termin 7e-08
3gj9_A124 Crystal Structure Of Tip-1 In Complex With C-Termin 8e-05
3dj3_A113 Crystal Structure Of C-Terminal Truncated Tip-1 (6- 8e-08
3dj3_A113 Crystal Structure Of C-Terminal Truncated Tip-1 (6- 7e-05
1mfg_A95 The Structure Of Erbin Pdz Domain Bound To The Carb 8e-08
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 1e-07
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 1e-07
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 3e-05
1qav_A90 Unexpected Modes Of Pdz Domain Scaffolding Revealed 2e-07
1qav_A90 Unexpected Modes Of Pdz Domain Scaffolding Revealed 1e-04
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 2e-07
3k1r_A192 Structure Of Harmonin Npdz1 In Complex With The Sam 3e-07
3k1r_A192 Structure Of Harmonin Npdz1 In Complex With The Sam 5e-04
1wg6_A127 Solution Structure Of Pdz Domain In Protein Xp_1108 3e-07
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 4e-07
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 3e-06
1nf3_C128 Structure Of Cdc42 In A Complex With The Gtpase-Bin 4e-07
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 5e-07
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 1e-04
1um1_A110 Solution Structure Of Rsgi Ruh-007, Pdz Domain In H 6e-07
1ihj_A98 Crystal Structure Of The N-Terminal Pdz Domain Of I 9e-07
2pdz_A86 Solution Structure Of The Syntrophin Pdz Domain In 1e-06
2pdz_A86 Solution Structure Of The Syntrophin Pdz Domain In 4e-05
1z86_A87 Solution Structure Of The Pdz Domain Of Alpha-Syntr 1e-06
1z86_A87 Solution Structure Of The Pdz Domain Of Alpha-Syntr 4e-05
2fcf_A103 The Crystal Structure Of The 7th Pdz Domain Of Mpdz 1e-06
2iwq_A123 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 1e-06
1z87_A263 Solution Structure Of The Split Ph-Pdz Supramodule 1e-06
1z87_A263 Solution Structure Of The Split Ph-Pdz Supramodule 1e-05
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 1e-06
2iwn_A97 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz 1e-06
2kbs_A92 Solution Structure Of Harmonin Pdz2 In Complex With 1e-06
1x8s_A102 Structure Of The Par-6 Pdz Domain With A Pals1 Inte 2e-06
1rzx_A98 Crystal Structure Of A Par-6 Pdz-Peptide Complex Le 2e-06
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 2e-06
1pdr_A99 Crystal Structure Of The Third Pdz Domain From The 2e-06
3hvq_C170 Crystal Structure Of A Complex Between Protein Phos 2e-06
1ry4_A128 Nmr Structure Of The Crib-Pdz Module Of Par-6 Lengt 3e-06
2lc6_A128 Solution Structure Of Par-6 Q144cL164C Length = 128 4e-06
1wf8_A107 Solution Structure Of The Pdz Domain Of Spinophilin 6e-06
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 6e-06
2fn5_A94 Nmr Structure Of The Neurabin Pdz Domain (502-594) 6e-06
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 7e-06
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 5e-05
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 7e-06
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 5e-05
2i0i_A85 X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The 8e-06
1mc7_A95 Solution Structure Of Mdvl1 Pdz Domain Length = 95 8e-06
1u3b_A185 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 8e-06
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 8e-06
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 5e-05
2g5m_B113 Spinophilin Pdz Domain Length = 113 9e-06
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 1e-05
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 1e-05
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 5e-05
3egh_C170 Crystal Structure Of A Complex Between Protein Phos 1e-05
3egg_C170 Crystal Structure Of A Complex Between Protein Phos 1e-05
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 1e-05
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 7e-05
1uit_A117 Solution Structure Of Rsgi Ruh-006, The Third Pdz D 1e-05
2rey_A100 Crystal Structure Of The Pdz Domain Of Human Dishev 2e-05
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 2e-05
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 2e-05
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 2e-05
2iwo_A120 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 2e-05
3b76_A118 Crystal Structure Of The Third Pdz Domain Of Human 2e-05
2lob_A112 Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Re 2e-05
2lob_A112 Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Re 9e-05
2dmz_A129 Solution Structure Of The Third Pdz Domain Of Human 3e-05
2pkt_A91 Crystal Structure Of The Human Clp-36 (Pdlim1) Boun 3e-05
3cc0_A108 The Dvl2 Pdz Domain In Complex With The N3 Inhibito 3e-05
3cbx_A105 The Dvl2 Pdz Domain In Complex With The C1 Inhibito 4e-05
2kaw_A90 Nmr Structure Of The Mdvl1 Pdz Domain In Complex Wi 4e-05
2ehr_A117 Solution Structure Of The Sixth Pdz Domain Of Human 5e-05
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 5e-05
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 8e-05
1wi4_A109 Solution Structure Of The Pdz Domain Of Syntaxin Bi 5e-05
3cby_A108 The Dvl2 Pdz Domain In Complex With The N1 Inhibito 6e-05
3fy5_A91 Dishevelled Pdz Domain Homodimer Length = 91 8e-05
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 9e-05
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 4e-04
3cbz_A108 The Dvl2 Pdz Domain In Complex With The N2 Inhibito 9e-05
2f0a_A98 Crystal Structure Of Monomeric Uncomplexed Form Of 1e-04
2vwr_A95 Crystal Structure Of The Second Pdz Domain Of Numb- 1e-04
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 1e-04
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 3e-04
1l6o_A95 Xenopus Dishevelled Pdz Domain Length = 95 1e-04
2vph_A100 Crystal Structure Of The Human Protein Tyrosine Pho 1e-04
1wh1_A124 Solution Structure Of The Fourth Pdz Domain Of Kiaa 2e-04
2cs5_A119 Solution Structure Of Pdz Domain Of Protein Tyrosin 2e-04
1ufx_A103 Solution Structure Of The Third Pdz Domain Of Human 2e-04
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 2e-04
3nfk_A107 Crystal Structure Of The Ptpn4 Pdz Domain Complexed 2e-04
2db5_A128 Solution Structure Of The First Pdz Domain Of Inad- 2e-04
1n7e_A97 Crystal Structure Of The Sixth Pdz Domain Of Grip1 3e-04
2q9v_A90 Crystal Structure Of The C890s Mutant Of The 4th Pd 4e-04
2q9v_A90 Crystal Structure Of The C890s Mutant Of The 4th Pd 4e-04
1v5l_A103 Solution Structure Of Pdz Domain Of Mouse Alpha-Act 5e-04
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 7e-04
1obz_A166 Crystal Structure Of The Complex Of The Pdz Tandem 9e-04
2he4_A90 The Crystal Structure Of The Second Pdz Domain Of H 9e-04
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (296), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 103/180 (57%), Gaps = 11/180 (6%)
Query: 171 LGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHE 230
           LGFSI GGTD+   P     P IFI+ I+PGG AA  G+LR+ D IL VN  DV +VTH 
Sbjct: 72  LGFSIAGGTDN---PHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHS 128
Query: 231 EAVLALLEPCPEILLKI-QHDPHPEGFQEITLIRQEGEK-LGMHIKGGLRGQRGNPLDKN 288
            AV AL E    + L + +  P  E   EI LI+  G K LG  I GG+    GN     
Sbjct: 129 AAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIK--GPKGLGFSIAGGV----GNQHIPG 182
Query: 289 DEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCK 348
           D  +++TKI  GGAA +DGRL++G ++L VN + L    H++AV  L+ +   + L V K
Sbjct: 183 DNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAK 242
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|2QT5|A Chain A, Crystal Structure Of Grip1 Pdz12 In Complex With The Fras1 Peptide Length = 200 Back     alignment and structure
>pdb|2QT5|A Chain A, Crystal Structure Of Grip1 Pdz12 In Complex With The Fras1 Peptide Length = 200 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|2JIL|A Chain A, Crystal Structure Of 2nd Pdz Domain Of Glutamate Receptor Interacting Protein-1 (Grip1) Length = 97 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|2VZ5|A Chain A, Structure Of The Pdz Domain Of Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3 Length = 139 Back     alignment and structure
>pdb|2VZ5|A Chain A, Structure Of The Pdz Domain Of Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3 Length = 139 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|2H3L|A Chain A, Crystal Structure Of Erbin Pdz Length = 103 Back     alignment and structure
>pdb|3DIW|A Chain A, C-Terminal Beta-Catenin Bound Tip-1 Structure Length = 124 Back     alignment and structure
>pdb|3DIW|A Chain A, C-Terminal Beta-Catenin Bound Tip-1 Structure Length = 124 Back     alignment and structure
>pdb|4E3B|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36-L (Ansrwptsil) Peptide Length = 102 Back     alignment and structure
>pdb|4E3B|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36-L (Ansrwptsil) Peptide Length = 102 Back     alignment and structure
>pdb|3SFJ|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36 Inhibitor Peptide Length = 104 Back     alignment and structure
>pdb|3SFJ|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36 Inhibitor Peptide Length = 104 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|2KG2|A Chain A, Solution Structure Of A Pdz Protein Length = 124 Back     alignment and structure
>pdb|2KG2|A Chain A, Solution Structure Of A Pdz Protein Length = 124 Back     alignment and structure
>pdb|3CH8|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|2QBW|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|1P1D|A Chain A, Structural Insights Into The Inter-Domain Chaperoning Of Tandem Pdz Domains In Glutamate Receptor Interacting Proteins Length = 196 Back     alignment and structure
>pdb|3GJ9|A Chain A, Crystal Structure Of Tip-1 In Complex With C-Terminal Of Kir2.3 Length = 124 Back     alignment and structure
>pdb|3GJ9|A Chain A, Crystal Structure Of Tip-1 In Complex With C-Terminal Of Kir2.3 Length = 124 Back     alignment and structure
>pdb|3DJ3|A Chain A, Crystal Structure Of C-Terminal Truncated Tip-1 (6-113) Length = 113 Back     alignment and structure
>pdb|3DJ3|A Chain A, Crystal Structure Of C-Terminal Truncated Tip-1 (6-113) Length = 113 Back     alignment and structure
>pdb|1MFG|A Chain A, The Structure Of Erbin Pdz Domain Bound To The Carboxy- Terminal Tail Of The Erbb2 Receptor Length = 95 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|1QAV|A Chain A, Unexpected Modes Of Pdz Domain Scaffolding Revealed By Structure Of Nnos-Syntrophin Complex Length = 90 Back     alignment and structure
>pdb|1QAV|A Chain A, Unexpected Modes Of Pdz Domain Scaffolding Revealed By Structure Of Nnos-Syntrophin Complex Length = 90 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|3K1R|A Chain A, Structure Of Harmonin Npdz1 In Complex With The Sam-Pbm Of Sans Length = 192 Back     alignment and structure
>pdb|3K1R|A Chain A, Structure Of Harmonin Npdz1 In Complex With The Sam-Pbm Of Sans Length = 192 Back     alignment and structure
>pdb|1WG6|A Chain A, Solution Structure Of Pdz Domain In Protein Xp_110852 Length = 127 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|1NF3|C Chain C, Structure Of Cdc42 In A Complex With The Gtpase-Binding Domain Of The Cell Polarity Protein, Par6 Length = 128 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|1UM1|A Chain A, Solution Structure Of Rsgi Ruh-007, Pdz Domain In Human Cdna Length = 110 Back     alignment and structure
>pdb|1IHJ|A Chain A, Crystal Structure Of The N-Terminal Pdz Domain Of Inad In Complex With A Norpa C-Terminal Peptide Length = 98 Back     alignment and structure
>pdb|2PDZ|A Chain A, Solution Structure Of The Syntrophin Pdz Domain In Complex With The Peptide Gvkeslv, Nmr, 15 Structures Length = 86 Back     alignment and structure
>pdb|2PDZ|A Chain A, Solution Structure Of The Syntrophin Pdz Domain In Complex With The Peptide Gvkeslv, Nmr, 15 Structures Length = 86 Back     alignment and structure
>pdb|1Z86|A Chain A, Solution Structure Of The Pdz Domain Of Alpha-Syntrophin Length = 87 Back     alignment and structure
>pdb|1Z86|A Chain A, Solution Structure Of The Pdz Domain Of Alpha-Syntrophin Length = 87 Back     alignment and structure
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 Back     alignment and structure
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz Length = 123 Back     alignment and structure
>pdb|1Z87|A Chain A, Solution Structure Of The Split Ph-Pdz Supramodule Of Alpha- Syntrophin Length = 263 Back     alignment and structure
>pdb|1Z87|A Chain A, Solution Structure Of The Split Ph-Pdz Supramodule Of Alpha- Syntrophin Length = 263 Back     alignment and structure
>pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure
>pdb|2IWN|A Chain A, 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 97 Back     alignment and structure
>pdb|2KBS|A Chain A, Solution Structure Of Harmonin Pdz2 In Complex With The Carboxyl Tail Peptide Of Cadherin23 Length = 92 Back     alignment and structure
>pdb|1X8S|A Chain A, Structure Of The Par-6 Pdz Domain With A Pals1 Internal Ligand Length = 102 Back     alignment and structure
>pdb|1RZX|A Chain A, Crystal Structure Of A Par-6 Pdz-Peptide Complex Length = 98 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|1PDR|A Chain A, Crystal Structure Of The Third Pdz Domain From The Human Homolog Of Discs Large Protein Length = 99 Back     alignment and structure
>pdb|3HVQ|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Neurabin Length = 170 Back     alignment and structure
>pdb|1RY4|A Chain A, Nmr Structure Of The Crib-Pdz Module Of Par-6 Length = 128 Back     alignment and structure
>pdb|2LC6|A Chain A, Solution Structure Of Par-6 Q144cL164C Length = 128 Back     alignment and structure
>pdb|1WF8|A Chain A, Solution Structure Of The Pdz Domain Of SpinophilinNEURABINII PROTEIN Length = 107 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|2FN5|A Chain A, Nmr Structure Of The Neurabin Pdz Domain (502-594) Length = 94 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|2I0I|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|1MC7|A Chain A, Solution Structure Of Mdvl1 Pdz Domain Length = 95 Back     alignment and structure
>pdb|1U3B|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 185 Back     alignment and structure
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2G5M|B Chain B, Spinophilin Pdz Domain Length = 113 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|3EGH|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1), The Pp1 Binding And Pdz Domains Of Spinophilin And The Small Natural Molecular Toxin Nodularin-R Length = 170 Back     alignment and structure
>pdb|3EGG|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 170 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|1UIT|A Chain A, Solution Structure Of Rsgi Ruh-006, The Third Pdz Domain Of Hdlg5 (Kiaa0583) Protein [homo Sapiens] Length = 117 Back     alignment and structure
>pdb|2REY|A Chain A, Crystal Structure Of The Pdz Domain Of Human Dishevelled 2 (Homologous To Drosophila Dsh) Length = 100 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure
>pdb|2IWO|A Chain A, 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 120 Back     alignment and structure
>pdb|3B76|A Chain A, Crystal Structure Of The Third Pdz Domain Of Human Ligand-of-numb Protein-x (lnx1) In Complex With The C-terminal Peptide From The Coxsackievirus And Adenovirus Receptor Length = 118 Back     alignment and structure
>pdb|2LOB|A Chain A, Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Regulator-Associated Ligand) Length = 112 Back     alignment and structure
>pdb|2LOB|A Chain A, Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Regulator-Associated Ligand) Length = 112 Back     alignment and structure
>pdb|2DMZ|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Inad- Like Protein Length = 129 Back     alignment and structure
>pdb|2PKT|A Chain A, Crystal Structure Of The Human Clp-36 (Pdlim1) Bound To The C-Terminal Peptide Of Human Alpha-Actinin-1 Length = 91 Back     alignment and structure
>pdb|3CC0|A Chain A, The Dvl2 Pdz Domain In Complex With The N3 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|3CBX|A Chain A, The Dvl2 Pdz Domain In Complex With The C1 Inhibitory Peptide Length = 105 Back     alignment and structure
>pdb|2KAW|A Chain A, Nmr Structure Of The Mdvl1 Pdz Domain In Complex With Its Inhibitor Length = 90 Back     alignment and structure
>pdb|2EHR|A Chain A, Solution Structure Of The Sixth Pdz Domain Of Human Inad- Like Protein Length = 117 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|1WI4|A Chain A, Solution Structure Of The Pdz Domain Of Syntaxin Binding Protein 4 Length = 109 Back     alignment and structure
>pdb|3CBY|A Chain A, The Dvl2 Pdz Domain In Complex With The N1 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|3FY5|A Chain A, Dishevelled Pdz Domain Homodimer Length = 91 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|3CBZ|A Chain A, The Dvl2 Pdz Domain In Complex With The N2 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|2F0A|A Chain A, Crystal Structure Of Monomeric Uncomplexed Form Of Xenopus Dishevelled Pdz Domain Length = 98 Back     alignment and structure
>pdb|2VWR|A Chain A, Crystal Structure Of The Second Pdz Domain Of Numb-Binding Protein 2 Length = 95 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|1L6O|A Chain A, Xenopus Dishevelled Pdz Domain Length = 95 Back     alignment and structure
>pdb|2VPH|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Non-Receptor Type 4, Pdz Domain Length = 100 Back     alignment and structure
>pdb|1WH1|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Kiaa1095 Protein Length = 124 Back     alignment and structure
>pdb|2CS5|A Chain A, Solution Structure Of Pdz Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 4 Length = 119 Back     alignment and structure
>pdb|1UFX|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Kiaa1526 Protein Length = 103 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|3NFK|A Chain A, Crystal Structure Of The Ptpn4 Pdz Domain Complexed With The C- Terminus Of A Rabies Virus G Protein Length = 107 Back     alignment and structure
>pdb|2DB5|A Chain A, Solution Structure Of The First Pdz Domain Of Inad-Like Protein Length = 128 Back     alignment and structure
>pdb|1N7E|A Chain A, Crystal Structure Of The Sixth Pdz Domain Of Grip1 Length = 97 Back     alignment and structure
>pdb|2Q9V|A Chain A, Crystal Structure Of The C890s Mutant Of The 4th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 90 Back     alignment and structure
>pdb|2Q9V|A Chain A, Crystal Structure Of The C890s Mutant Of The 4th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 90 Back     alignment and structure
>pdb|1V5L|A Chain A, Solution Structure Of Pdz Domain Of Mouse Alpha-Actinin-2 Associated Lim Protein Length = 103 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|1OBZ|A Chain A, Crystal Structure Of The Complex Of The Pdz Tandem Of Syntenin With An Interleukin 5 Receptor Alpha Peptide. Length = 166 Back     alignment and structure
>pdb|2HE4|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Nherf-2 (Slc9a3r2) Interacting With A Mode 1 Pdz Binding Motif Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-63
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 6e-24
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 8e-21
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-08
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-07
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-56
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 3e-23
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-22
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-08
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 5e-06
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-55
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 9e-21
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-08
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 8e-06
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-50
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-08
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-44
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 4e-30
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-22
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-38
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-07
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 3e-36
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-23
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 3e-11
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 5e-34
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-06
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 6e-04
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 4e-32
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 9e-25
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 3e-11
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 1e-30
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 1e-25
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 3e-08
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 3e-30
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 5e-27
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 5e-09
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 4e-30
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 4e-27
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 8e-09
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 5e-30
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-26
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 7e-11
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-30
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-22
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-10
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-29
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-27
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-08
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 8e-29
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-27
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-10
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 9e-29
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 4e-26
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 4e-08
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-28
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 1e-23
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 5e-09
2o2t_A117 Multiple PDZ domain protein; structural protein, s 7e-28
2o2t_A117 Multiple PDZ domain protein; structural protein, s 3e-25
2o2t_A117 Multiple PDZ domain protein; structural protein, s 3e-07
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-27
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-25
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-08
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-27
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 5e-25
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-07
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 1e-27
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 3e-22
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 5e-09
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 2e-27
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 4e-23
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 1e-07
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-27
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 3e-24
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 7e-08
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-27
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 4e-27
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-09
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-27
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-26
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 3e-08
2byg_A117 Channel associated protein of synapse-110; DLG2, P 3e-27
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-25
2byg_A117 Channel associated protein of synapse-110; DLG2, P 7e-09
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 4e-27
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-23
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-08
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 5e-27
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 3e-22
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 1e-07
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 7e-27
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-23
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 6e-09
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 8e-27
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 4e-20
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 5e-06
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 9e-27
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 4e-21
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-07
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-26
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-22
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-10
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 1e-26
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-23
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-07
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 1e-26
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 7e-26
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 4e-09
2fne_A117 Multiple PDZ domain protein; structural protein, s 1e-26
2fne_A117 Multiple PDZ domain protein; structural protein, s 5e-24
2fne_A117 Multiple PDZ domain protein; structural protein, s 4e-09
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-26
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-23
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 6e-10
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-26
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 4e-26
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-08
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-26
2opg_A98 Multiple PDZ domain protein; structural protein, s 1e-22
2opg_A98 Multiple PDZ domain protein; structural protein, s 3e-08
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-26
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 1e-23
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 5e-08
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-26
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 7e-23
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-08
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 3e-26
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 3e-24
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 9e-09
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-26
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-22
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 7e-08
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 3e-26
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 4e-24
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 9e-10
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 6e-26
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-22
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-08
2awx_A105 Synapse associated protein 97; membrane protein, s 7e-26
2awx_A105 Synapse associated protein 97; membrane protein, s 8e-24
2awx_A105 Synapse associated protein 97; membrane protein, s 2e-08
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 8e-26
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-22
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 2e-09
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 9e-26
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-23
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 7e-08
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 1e-25
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 4e-20
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 1e-07
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-25
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-22
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-07
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-25
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-25
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 3e-08
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 3e-25
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-20
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 9e-07
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 3e-25
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-24
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 7e-08
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 3e-25
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 3e-24
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 4e-09
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 9e-25
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 9e-19
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 6e-06
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 1e-24
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 7e-24
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 7e-08
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 1e-24
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 3e-23
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 9e-09
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-24
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 9e-24
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 6e-09
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-24
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 6e-19
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-07
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 2e-24
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-21
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 5e-08
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-24
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-22
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-08
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 2e-24
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 5e-23
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 3e-08
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-24
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-22
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 8e-07
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-24
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-23
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-08
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 3e-24
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 6e-22
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-07
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 4e-24
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-21
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-08
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 4e-24
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-23
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 6e-08
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 4e-24
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 6e-22
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 1e-07
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 4e-24
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-21
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 1e-06
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 4e-24
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 9e-22
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 6e-08
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 5e-24
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 1e-23
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 9e-08
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 7e-24
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 5e-16
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 7e-05
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-23
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 9e-23
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 6e-07
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-23
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-22
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-08
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-23
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 4e-23
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-08
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-23
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-21
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-07
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 3e-23
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 1e-21
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 1e-07
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 3e-23
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-23
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 7e-06
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 4e-23
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 6e-22
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 3e-07
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 4e-23
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 5e-21
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 4e-08
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 5e-23
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 3e-21
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 3e-07
3k1r_A192 Harmonin; protein-protein complex, alternative spl 5e-23
3k1r_A192 Harmonin; protein-protein complex, alternative spl 2e-18
3k1r_A192 Harmonin; protein-protein complex, alternative spl 2e-05
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 8e-23
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-21
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-07
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 1e-22
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 3e-21
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 7e-07
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-22
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-22
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-07
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 1e-22
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 6e-22
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-08
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-22
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 6e-21
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 3e-07
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-22
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 1e-21
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 4e-07
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-22
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 5e-22
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-08
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-22
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 1e-18
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 7e-07
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-22
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-17
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 5e-05
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 5e-22
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 8e-16
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-06
2eeh_A100 PDZ domain-containing protein 7; structural genomi 7e-22
2eeh_A100 PDZ domain-containing protein 7; structural genomi 7e-20
2eeh_A100 PDZ domain-containing protein 7; structural genomi 4e-06
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-21
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 2e-21
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 4e-19
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 4e-07
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-21
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 3e-20
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 7e-07
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-21
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-18
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 4e-21
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-14
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 3e-06
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 4e-21
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 2e-17
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 2e-07
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 6e-21
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 7e-21
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 3e-06
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 7e-21
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 5e-17
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 6e-06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 7e-21
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-15
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 5e-06
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 9e-21
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 1e-15
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 1e-04
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-20
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 3e-19
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-07
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 1e-20
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 1e-16
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-05
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 2e-20
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 5e-17
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 3e-06
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-20
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-19
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-06
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-20
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 3e-14
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 1e-06
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 3e-20
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 1e-17
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 6e-06
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 6e-20
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 2e-17
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 9e-07
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-19
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-19
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 2e-05
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-19
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-16
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-06
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 1e-19
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 9e-15
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 5e-06
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-19
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 4e-19
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 8e-07
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 1e-19
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 5e-15
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-06
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 1e-19
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 6e-15
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 1e-06
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-19
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 1e-11
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-19
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 6e-16
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 1e-06
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 4e-19
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 5e-15
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 5e-07
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 5e-19
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 8e-14
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-06
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 5e-19
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 4e-17
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-04
2ego_A96 General receptor for phosphoinositides 1- associat 6e-19
2ego_A96 General receptor for phosphoinositides 1- associat 1e-14
2ego_A96 General receptor for phosphoinositides 1- associat 8e-08
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 7e-19
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 8e-17
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 4e-07
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 9e-18
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 7e-17
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 7e-07
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 4e-17
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 3e-13
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 7e-07
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 5e-17
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-14
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-06
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 5e-17
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-13
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 9e-07
2eei_A106 PDZ domain-containing protein 1; regulatory factor 5e-17
2eei_A106 PDZ domain-containing protein 1; regulatory factor 4e-16
2eei_A106 PDZ domain-containing protein 1; regulatory factor 3e-07
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 1e-16
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 6e-15
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 3e-06
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-16
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-14
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-06
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 4e-16
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 1e-14
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-07
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 5e-16
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 2e-15
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 8e-07
2eaq_A90 LIM domain only protein 7; conserved hypothetical 6e-16
2eaq_A90 LIM domain only protein 7; conserved hypothetical 3e-12
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-04
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 6e-16
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 3e-14
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 3e-06
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 7e-16
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 3e-14
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 8e-06
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 8e-16
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-13
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-07
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 1e-15
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 4e-15
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 9e-07
3khf_A99 Microtubule-associated serine/threonine-protein ki 2e-15
3khf_A99 Microtubule-associated serine/threonine-protein ki 1e-13
3khf_A99 Microtubule-associated serine/threonine-protein ki 5e-07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 2e-15
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 3e-11
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 2e-07
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-15
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 4e-15
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 1e-06
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-15
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 4e-15
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 4e-07
2v90_A96 PDZ domain-containing protein 3; membrane, protein 3e-15
2v90_A96 PDZ domain-containing protein 3; membrane, protein 3e-14
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-07
2d90_A102 PDZ domain containing protein 1; structural genomi 7e-15
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-14
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-06
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-14
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-12
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 4e-05
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-14
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 8e-13
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 3e-05
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-14
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-13
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-14
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 5e-13
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 3e-06
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 3e-14
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-13
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 6e-14
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-13
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-05
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 7e-14
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 4e-13
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 2e-05
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-13
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-13
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 8e-06
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2e-13
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 1e-10
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 5e-04
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-13
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-11
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 1e-06
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 3e-13
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 1e-07
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 7e-13
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 3e-05
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 8e-13
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-05
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 5e-12
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 3e-11
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 5e-05
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 1e-11
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 1e-09
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 1e-04
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 1e-10
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 5e-10
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 9e-10
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-08
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 1e-04
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 5e-09
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 1e-06
2hga_A125 Conserved protein MTH1368; GFT structural genomics 2e-05
2kl1_A94 YLBL protein; structure genomics, structural genom 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 1e-04
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 2e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-04
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 3e-04
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 7e-04
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 8e-04
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
 Score =  201 bits (514), Expect = 3e-63
 Identities = 74/195 (37%), Positives = 104/195 (53%), Gaps = 8/195 (4%)

Query: 155 SSSLFLQDVVLPKS-GPLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMG 213
           S S+  +++ L +    LGFSI GGTD+   P     P IFI+ I+PGG AA  G+LR+ 
Sbjct: 1   SGSMEYEEITLERGNSGLGFSIAGGTDN---PHIGDDPSIFITKIIPGGAAAQDGRLRVN 57

Query: 214 DRILAVNGRDVSKVTHEEAVLALLEPCPEILLKIQHDPHPEGFQEITLIRQEGEKLGMHI 273
           D IL VN  DV +VTH  AV AL E    + L +     P        + +  + LG  I
Sbjct: 58  DSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSI 117

Query: 274 KGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVN 333
            GG     GN     D  +++TKI  GGAA +DGRL++G ++L VN + L    H++AV 
Sbjct: 118 AGG----VGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVA 173

Query: 334 TLRYSGHQISLTVCK 348
            L+ +   + L V K
Sbjct: 174 ALKNTYDVVYLKVAK 188
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.97
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.95
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.94
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.91
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.91
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.9
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.86
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.86
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.83
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.83
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.79
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.77
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.75
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.74
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.73
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.68
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.65
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.62
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.59
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.58
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.57
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.53
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.52
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.51
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.51
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.5
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.49
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.49
2awx_A105 Synapse associated protein 97; membrane protein, s 99.47
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.47
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.46
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.45
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.45
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.45
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.45
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.44
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.44
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.44
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.44
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.44
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.44
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.43
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.43
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.43
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.43
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.43
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.43
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.43
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.43
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.43
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.43
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.42
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.42
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.42
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.42
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.42
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.42
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.42
2awx_A105 Synapse associated protein 97; membrane protein, s 99.42
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.42
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.41
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.41
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.41
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.41
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.41
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.4
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.4
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.4
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.4
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.4
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.4
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.4
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.4
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.4
2d90_A102 PDZ domain containing protein 1; structural genomi 99.4
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.39
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.39
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.39
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.39
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.39
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.39
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.39
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.39
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.39
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.39
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.39
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.39
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.39
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.39
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.39
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.38
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.38
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.38
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.38
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.38
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.38
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.38
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.38
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.38
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.38
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.38
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.38
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.38
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.38
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.38
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.38
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.38
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.38
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.38
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.38
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.38
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.38
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.38
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.38
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.38
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.37
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.37
2ego_A96 General receptor for phosphoinositides 1- associat 99.37
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.37
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.37
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.37
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.37
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.37
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.37
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.37
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.37
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.37
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.37
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.37
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.37
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.37
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.37
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.37
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.36
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.36
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.36
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.36
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.36
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.36
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.36
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.36
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.36
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.36
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.36
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.36
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.36
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.36
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.35
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.35
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.35
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.35
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.35
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.35
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.35
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.35
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.35
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.35
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.35
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.35
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.35
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.35
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.34
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.34
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.34
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.34
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.34
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.34
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.34
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.34
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.34
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.34
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.34
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.34
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.34
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.34
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.34
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.34
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.33
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.33
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.33
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.33
2ego_A96 General receptor for phosphoinositides 1- associat 99.33
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.33
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.33
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.33
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.32
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.32
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.32
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.32
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.32
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.32
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.32
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.32
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.32
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.31
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.31
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.31
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.31
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.31
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.31
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.31
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.31
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.31
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.31
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.31
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.31
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.31
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.31
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.3
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.3
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.3
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.3
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.3
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.3
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.3
2d90_A102 PDZ domain containing protein 1; structural genomi 99.3
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.3
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.3
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.3
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.29
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.29
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.29
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.29
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.29
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.29
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.29
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.28
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.28
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.28
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.28
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.28
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.28
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.28
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.27
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.27
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.27
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.27
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.27
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.27
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.26
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.26
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.26
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.26
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.26
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.26
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.26
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.26
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.25
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.25
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.25
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.25
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.25
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.25
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.25
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.25
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.25
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.25
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.24
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.24
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.24
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.23
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.23
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.23
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.23
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.23
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.23
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.23
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.23
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.22
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.22
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.22
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.22
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.21
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.21
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.21
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.2
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.2
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.2
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.2
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.2
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.2
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.2
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.2
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.19
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.19
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.19
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.19
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.19
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.19
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.19
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.18
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.18
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.18
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.18
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.18
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.17
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.16
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.15
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.15
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.15
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.14
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.14
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.14
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.13
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.13
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.13
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.73
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.13
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.12
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.12
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.11
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.11
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.11
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.11
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.1
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.1
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.1
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.09
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.09
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.09
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.09
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.08
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.07
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.62
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.03
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.01
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.01
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.99
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.99
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.98
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.96
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.96
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.95
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.93
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.91
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.9
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.85
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.85
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.8
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.79
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.77
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.64
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.61
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.59
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.59
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.59
2kl1_A94 YLBL protein; structure genomics, structural genom 98.58
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.58
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.57
2kl1_A94 YLBL protein; structure genomics, structural genom 98.56
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.54
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.52
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.52
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.49
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.49
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.45
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.42
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.41
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.36
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.36
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.32
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.29
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.26
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.26
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.24
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.23
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.21
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.14
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.1
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.1
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.09
3k50_A403 Putative S41 protease; structural genomics, joint 97.98
3k50_A 403 Putative S41 protease; structural genomics, joint 97.96
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.95
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.94
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.73
1k32_A 1045 Tricorn protease; protein degradation, substrate g 96.94
1k32_A1045 Tricorn protease; protein degradation, substrate g 96.85
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
Probab=99.97  E-value=1.6e-29  Score=269.75  Aligned_cols=242  Identities=31%  Similarity=0.484  Sum_probs=191.5

Q ss_pred             ccccCcceeEEe------cCcccc-cCCCCEEEEECCeecCCCCHHHHHHHHhhcCCeEEEEEEeccccCccccccCCCC
Q psy4596           9 PWTGEQAGVILA------AGEVVI-HPVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERGDIERRASTSE   81 (439)
Q Consensus         9 ~~~~~~~Gi~vs------a~~~~g-L~~GD~Il~VNG~~v~~~~~~~~v~~l~~~~~~v~L~V~R~~~~~~~~~~~~~~~   81 (439)
                      |+.....|++|+      +|..+| |++||+|++|||+++.+++|.+++.+|+.++..|+|+|.|.....          
T Consensus        83 ~~~~~~~g~~V~~v~~gspA~~aG~L~~GD~Il~Vng~~v~~~~~~~~~~~l~~~g~~v~l~v~R~~~~~----------  152 (721)
T 2xkx_A           83 PHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPA----------  152 (721)
T ss_pred             cccCCCCCeEEEEeCCCCHHHhcCCCCCCCEEEEECCEECCCCCHHHHHHHhhccccccceEEEeccccc----------
Confidence            344457899997      445556 999999999999999999999999999999999999998832000          


Q ss_pred             CCCCccccCCCCCcCCCcccccccCccceeeeccccCCCCCCCCCCCCcccccCCCCCcccccccCcCCCCCCCCCceeE
Q psy4596          82 GSRSVTQSMSSLDREDLDTDVFKQGQWSTVVTAHQRLDTGYGLPSNSTVAAHISSSLKPSILVTYNFFSPSVRSSSLFLQ  161 (439)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~  161 (439)
                                                                                                  ....
T Consensus       153 ----------------------------------------------------------------------------~~~~  156 (721)
T 2xkx_A          153 ----------------------------------------------------------------------------EKVM  156 (721)
T ss_pred             ----------------------------------------------------------------------------ccce
Confidence                                                                                        0113


Q ss_pred             EEEEecCC-CccEEEeeCCCCCCCCCCCCCCcEEEEEECCCChhhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHHhCCC
Q psy4596         162 DVVLPKSG-PLGFSIIGGTDHSCIPFGQHKPGIFISHIVPGGVAALSGKLRMGDRILAVNGRDVSKVTHEEAVLALLEPC  240 (439)
Q Consensus       162 ~v~l~~~~-~lG~~i~~~~~~~~~~~g~~~~g~~V~~V~~~s~A~~~G~L~~GD~Il~VNg~~v~~~~~~~~~~~l~~~~  240 (439)
                      +|.|.+.. +|||++.++.+....   ....|++|..|.++|+|+++|+|++||+|++|||.++.+++|.+++..++..+
T Consensus       157 ~v~l~k~~~~lG~~i~~~~~~~~~---~~~~gv~V~~V~~gs~A~~aG~L~~GD~Il~Vng~~v~~~~~~~~~~~l~~~~  233 (721)
T 2xkx_A          157 EIKLIKGPKGLGFSIAGGVGNQHI---PGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTY  233 (721)
T ss_pred             eeeeeeecCCCceeeccCCCcccc---CCCCceEEEEeCCCCchhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHHHcCC
Confidence            35555543 799999887553211   12358999999999999999999999999999999999999999998888888


Q ss_pred             CeEEEEEecCCCCCC-----------------------------------------------------------cceeee
Q psy4596         241 PEILLKIQHDPHPEG-----------------------------------------------------------FQEITL  261 (439)
Q Consensus       241 ~~v~l~v~r~~~~~~-----------------------------------------------------------~~~v~l  261 (439)
                      ..+.|+|.|++....                                                           ...+.+
T Consensus       234 ~~v~l~V~R~g~~~~~~~~~~p~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~v~l  313 (721)
T 2xkx_A          234 DVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVI  313 (721)
T ss_pred             CeEEEEEEeCCcccccCCCCCCCcccCCCCCcccccCCcccccccccccCCCCCCcccCCcccccccccccccceEEEEE
Confidence            899999988764210                                                           000111


Q ss_pred             eeccCcccceeecCCccCCCCCCCCCCCCCeEEEEeCCCCchhhcCCCCCCCEEEEECCEEcCCCCHHHHHHHHhcCCCe
Q psy4596         262 IRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTLRYSGHQ  341 (439)
Q Consensus       262 ~~~~~~~lG~~i~~~~~~~~g~~~~~~~~gi~I~~v~~~s~A~~~G~L~~GD~Il~VNg~~v~~~~~~~~~~~l~~~~~~  341 (439)
                       ......|||.+.++.          ...|++|..|.++|+|+++|+|++||+|++|||++|.+++|++++++|++.+..
T Consensus       314 -~~~~~~lG~~i~~~~----------~~~gv~V~~V~~gs~A~~aG~L~~GD~Il~VNg~~v~~~~~~e~~~~l~~~~~~  382 (721)
T 2xkx_A          314 -HRGSTGLGFNIVGGE----------DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQT  382 (721)
T ss_pred             -EECCCCccEEEeccC----------CCCCeEEEEeCCCChHHhcCCCccCCEEEEECCEECCCCCHHHHHHHHHhcCCe
Confidence             122345788776542          134899999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEecCC
Q psy4596         342 ISLTVCKGF  350 (439)
Q Consensus       342 v~l~v~r~~  350 (439)
                      +.|+|.|..
T Consensus       383 v~L~v~r~~  391 (721)
T 2xkx_A          383 VTIIAQYKP  391 (721)
T ss_pred             EEEEEEeCc
Confidence            999998763
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 439
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-25
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-17
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-05
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 2e-22
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 8e-21
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 6e-06
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 2e-22
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 6e-21
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-05
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 5e-21
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 2e-19
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 1e-04
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 2e-20
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 1e-18
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 1e-05
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 6e-20
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-18
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 8e-07
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 8e-20
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-19
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 8e-05
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 9e-20
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-17
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-06
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-19
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 4e-15
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 7e-04
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 1e-19
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-18
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 1e-05
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-19
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 5e-19
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 1e-04
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 5e-19
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-18
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-04
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 9e-19
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 9e-17
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-05
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-18
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-18
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 1e-05
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-18
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 1e-14
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 1e-04
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 2e-18
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-16
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 2e-05
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 3e-18
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 2e-16
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-05
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 3e-18
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 2e-17
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 4e-05
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-18
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-14
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-07
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 4e-18
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 1e-17
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-06
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 4e-18
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 5e-16
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 6e-07
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 7e-18
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 2e-17
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 7e-05
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-17
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 5e-17
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 2e-06
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-17
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 2e-16
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 6e-04
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-17
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 1e-15
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-04
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-17
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-15
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-05
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 3e-17
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 6e-17
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 2e-06
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-17
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-17
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 4e-06
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 3e-17
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 3e-16
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 9e-06
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-17
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-16
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-05
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 7e-17
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 9e-15
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-05
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 1e-16
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-16
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-16
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 4e-14
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 7e-08
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-16
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 8e-15
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 7e-06
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-16
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 5e-14
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 6e-05
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 2e-16
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 4e-16
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 0.002
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-16
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-13
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-05
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-16
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-15
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 0.002
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-16
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-15
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-07
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 1e-15
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 9e-13
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 3e-04
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-15
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-15
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 2e-15
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-12
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 0.003
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 4e-15
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 5e-13
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 5e-07
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-15
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-14
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 9e-05
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 9e-15
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 6e-14
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 9e-07
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-14
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 4e-13
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 3e-04
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-14
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 5e-11
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 1e-05
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 3e-14
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 6e-14
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 1e-04
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 4e-14
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 6e-13
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 6e-14
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-14
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-04
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-14
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-11
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.004
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 9e-14
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-12
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 7e-06
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 1e-13
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-13
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 0.002
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 1e-13
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 1e-11
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 3e-13
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 1e-12
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 0.004
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 3e-13
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 6e-11
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-05
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 1e-11
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 5e-11
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 3e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-11
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 4e-11
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 0.003
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 1e-09
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 4e-08
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 4e-04
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-09
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-08
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-04
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 4e-08
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 4e-07
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 0.004
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 1e-06
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 1e-04
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 3e-05
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 6e-05
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 3e-04
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 1e-04
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 0.002
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Scribble (KIAA0147)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 96.6 bits (240), Expect = 5e-25
 Identities = 54/99 (54%), Positives = 71/99 (71%)

Query: 255 GFQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMR 314
           G +E+ + +  GE+LG+ I+GG RG  GNP D  DEG+FI+K++  GAA RDGRL+VG+R
Sbjct: 9   GLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLR 68

Query: 315 LLEVNGMSLLGASHQEAVNTLRYSGHQISLTVCKGFERG 353
           LLEVN  SLLG +H EAV  LR  G  +++ VC GFE G
Sbjct: 69  LLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFESG 107
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.73
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.72
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.71
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.69
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.69
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.68
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.68
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.68
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.67
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.66
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.65
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.65
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.65
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.65
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.63
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.63
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.63
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.63
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.63
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.63
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.62
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.62
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.62
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.61
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.61
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.61
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.6
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.6
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.6
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.6
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.6
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.6
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.6
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.59
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.59
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.59
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.59
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.59
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.58
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.57
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.57
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.57
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.57
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.57
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.56
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.56
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.56
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.55
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.55
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.55
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.55
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.54
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.54
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.54
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.54
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.54
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.54
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.54
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.54
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.53
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.53
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.53
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.53
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.53
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.52
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.52
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.52
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.52
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.52
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.5
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.5
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.5
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.49
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.49
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.49
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.49
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.48
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.48
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.47
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.47
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.47
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.47
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.47
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.45
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.45
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.43
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.43
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.43
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.42
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.42
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.42
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.41
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.4
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.4
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.39
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.36
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.36
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.35
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.35
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.35
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.34
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.32
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.31
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.27
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.22
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.1
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.05
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.03
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.02
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.01
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.95
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.93
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.83
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.82
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.8
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.73
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.72
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.65
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.64
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.63
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.5
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Scribble (KIAA0147)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.73  E-value=2.3e-18  Score=137.54  Aligned_cols=97  Identities=54%  Similarity=0.958  Sum_probs=87.2

Q ss_pred             cceeeeeeccCcccceeecCCccCCCCCCCCCCCCCeEEEEeCCCCchhhcCCCCCCCEEEEECCEEcCCCCHHHHHHHH
Q psy4596         256 FQEITLIRQEGEKLGMHIKGGLRGQRGNPLDKNDEGVFITKINSGGAAKRDGRLKVGMRLLEVNGMSLLGASHQEAVNTL  335 (439)
Q Consensus       256 ~~~v~l~~~~~~~lG~~i~~~~~~~~g~~~~~~~~gi~I~~v~~~s~A~~~G~L~~GD~Il~VNg~~v~~~~~~~~~~~l  335 (439)
                      .+++.+.+.....|||+|+++.....+........++||..|.++|+|+++|+|++||+||+|||++|.+++|++++++|
T Consensus        10 ~~~V~l~k~~~~~lG~~i~gG~~~~~~~~~~~~~~gi~I~~v~~gg~A~~~G~L~~GD~Il~VNg~~v~~~t~~ea~~~l   89 (111)
T d1ujua_          10 LRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLL   89 (111)
T ss_dssp             SSCEEEECCTTCCCCEEEECCSSSSCSCSSCTTCCCCEEEEECTTSHHHHHSSCCTTCBCCBBSSCBCTTSCHHHHHHHH
T ss_pred             eEEEEEEeCCCCccCEEEeccccCCcccccccCCCCEEEEEECCCChHHHcCCCccceeeeeeCCcccCCCCHHHHHHHH
Confidence            46777888878899999999887776666666778999999999999999999999999999999999999999999999


Q ss_pred             hcCCCeEEEEEecCCcc
Q psy4596         336 RYSGHQISLTVCKGFER  352 (439)
Q Consensus       336 ~~~~~~v~l~v~r~~~~  352 (439)
                      |+++..|+|+|+|.++.
T Consensus        90 k~~~~~v~L~V~r~~~~  106 (111)
T d1ujua_          90 RSVGDTLTVLVCDGFES  106 (111)
T ss_dssp             SSCSSEEEECCCCCCCC
T ss_pred             HcCCCeEEEEEEECCCC
Confidence            99999999999988653
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure