Diaphorina citri psyllid: psy4598


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MKGSWDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLKQYLDDGYKLVIFTNQGAIGRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPGMWEYLSQEKNGDLAIDISQSFYAGDAAGRAANWAPKKKKDFACTDHLFAFNLNLAFFTPEQIFLNEKAPDFPNLPTFKPREVYQKAQSQTIPNIPHDKKQVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSGLSVVVDNTNPDKESRHRYIEAAKQHGVRCIAVHMNISKEHAKHNIK
cccccEEECccEEEEEEccccccccEEEEEEccccEEEccccccccccccccEEccccHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHccccccccccccEEECcccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccHHHcccccccCEEEEccccccHHHHHHHHHHccccEEEEEECcccccccEEECccccccEEEEcccccccHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHcc
**GSWDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLKQYLDDGYKLVIFTNQGAIGRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPGMWEYLSQEKNGDLAIDISQSFYAGDAAGRAANWAPKKKKDFACTDHLFAFNLNLAFFTPEQIFLNEKAPDFPNLPTFKPREV****************KQVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSGLSVVVDNTNPDKESRHRYIEAAKQHGVRCIAVHMNISKEHAK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGSWDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLKQYLDDGYKLVIFTNQGAIGRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPGMWEYLSQEKNGDLAIDISQSFYAGDAAGRAANWAPKKKKDFACTDHLFAFNLNLAFFTPEQIFLNEKAPDFPNLPTFKPREVYQKAQSQTIPNIPHDKKQVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSGLSVVVDNTNPDKESRHRYIEAAKQHGVRCIAVHMNISKEHAKHNIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bifunctional polynucleotide phosphatase/kinase Catalyzes the phosphorylation of DNA at 5'-hydroxyl termini and can dephosphorylate its 3'-phosphate termini. Has a role in the repair of breaks in single stranded DNA.confidentO13911
Uncharacterized protein F21D5.5 confidentQ19683

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046404 [MF]ATP-dependent polydeoxyribonucleotide 5'-hydroxyl-kinase activityprobableGO:0051733, GO:0051731, GO:0051734, GO:0019205, GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0046403 [MF]polynucleotide 3'-phosphatase activityprobableGO:0016787, GO:0016791, GO:0019204, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0000718 [BP]nucleotide-excision repair, DNA damage removalprobableGO:0044238, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0044349, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0051716, GO:0046700, GO:0006974, GO:0006259, GO:0006950, GO:0008150, GO:0008152, GO:0034655, GO:0006289, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0019439, GO:0044763
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZVL, chain A
Confidence level:very confident
Coverage over the Query: 3-214,232-235,266-368
View the alignment between query and template
View the model in PyMOL
Template: 1YJ5, chain A
Confidence level:confident
Coverage over the Query: 12-270,320-367
View the alignment between query and template
View the model in PyMOL