Psyllid ID: psy4598
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 369 | ||||||
| 219911527 | 570 | polynucleotide kinase-3'-phosphatase [Ni | 0.853 | 0.552 | 0.457 | 4e-84 | |
| 346468451 | 592 | hypothetical protein [Amblyomma maculatu | 0.894 | 0.557 | 0.414 | 6e-82 | |
| 327275951 | 568 | PREDICTED: bifunctional polynucleotide p | 0.850 | 0.552 | 0.447 | 5e-80 | |
| 427789125 | 593 | hypothetical protein [Rhipicephalus pulc | 0.891 | 0.554 | 0.404 | 8e-79 | |
| 156360649 | 340 | predicted protein [Nematostella vectensi | 0.831 | 0.902 | 0.441 | 1e-78 | |
| 427778079 | 619 | hypothetical protein [Rhipicephalus pulc | 0.891 | 0.531 | 0.404 | 1e-78 | |
| 117606151 | 586 | bifunctional polynucleotide phosphatase/ | 0.831 | 0.523 | 0.430 | 8e-78 | |
| 442762141 | 552 | Putative polynucleotide kinase 3' phosph | 0.859 | 0.574 | 0.394 | 6e-77 | |
| 432894949 | 602 | PREDICTED: bifunctional polynucleotide p | 0.831 | 0.509 | 0.436 | 2e-75 | |
| 395858312 | 521 | PREDICTED: bifunctional polynucleotide p | 0.853 | 0.604 | 0.421 | 4e-75 |
| >gi|219911527|emb|CAX11689.1| polynucleotide kinase-3'-phosphatase [Nilaparvata lugens] | Back alignment and taxonomy information |
|---|
Score = 318 bits (814), Expect = 4e-84, Method: Compositional matrix adjust.
Identities = 167/365 (45%), Positives = 218/365 (59%), Gaps = 50/365 (13%)
Query: 5 WDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLK 64
W+ +D GKLL+++ + +S+KIAS+D+DGT+I TKSGKVFPVD +DWKL ++S LK
Sbjct: 195 WESIDQGKLLIYSVKGLRSSSKIASYDMDGTIILTKSGKVFPVDKNDWKLFSPAVKSQLK 254
Query: 65 QYLDDGYKLVIFTNQGAIGRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPG 124
+ DD +K+VIFTNQ I R K DF+ K EKI +L+VPVQ+FVAT D+YRKPVPG
Sbjct: 255 KLHDDNFKIVIFTNQAGISRGKTKVDDFKYKVEKITSALDVPVQVFVATSEDKYRKPVPG 314
Query: 125 MWEYLSQEKNGDLAIDISQSFYAGDAAGRAANWAPKKKKDFACTDHLFAFNLNLAFFTPE 184
MWE L Q+KN L S SF+ GDAAGR +WAPKKKKDF+C D LFA N+ + F+TP+
Sbjct: 315 MWEVLIQKKNDGLDYSESDSFFVGDAAGRVESWAPKKKKDFSCADRLFALNVGIKFYTPD 374
Query: 185 QIFLNEKAPDFPNLPTFKPREVYQKAQSQTIPNIPHDKKQVLIMIGSQGSGKSSFVSTYL 244
FL F LP F P +++ T I K+V++M+GS GSGKS F ++YL
Sbjct: 375 AHFLKLPEGKFA-LPGFNPSQLFSNNALITDKEILSKTKEVVVMVGSPGSGKSFFANSYL 433
Query: 245 KPLNYTTVNRDTLGSWQKCVSVMKAALDSVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRD 304
Y+ VNRDTLGSWQKCVS M++A
Sbjct: 434 VKAGYSCVNRDTLGSWQKCVSSMESA---------------------------------- 459
Query: 305 TLGSWQKCVSVMKAALDSGLSVVVDNTNPDKESRHRYIEAAKQHGVRCIAVHMNISKEHA 364
L +G SVVVDNTNPD+E+R RYI+ A + + C M+ + EHA
Sbjct: 460 ---------------LHAGNSVVVDNTNPDQETRKRYIDVAAKLNISCRCFLMSTTLEHA 504
Query: 365 KHNIK 369
+ N K
Sbjct: 505 RRNNK 509
|
Source: Nilaparvata lugens Species: Nilaparvata lugens Genus: Nilaparvata Family: Delphacidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|346468451|gb|AEO34070.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|327275951|ref|XP_003222735.1| PREDICTED: bifunctional polynucleotide phosphatase/kinase-like [Anolis carolinensis] | Back alignment and taxonomy information |
|---|
| >gi|427789125|gb|JAA60014.1| hypothetical protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|156360649|ref|XP_001625139.1| predicted protein [Nematostella vectensis] gi|156211956|gb|EDO33039.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|427778079|gb|JAA54491.1| hypothetical protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|117606151|ref|NP_001071046.1| bifunctional polynucleotide phosphatase/kinase [Danio rerio] gi|115527807|gb|AAI24635.1| Zgc:153084 [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|442762141|gb|JAA73229.1| Putative polynucleotide kinase 3' phosphatase, partial [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|432894949|ref|XP_004076011.1| PREDICTED: bifunctional polynucleotide phosphatase/kinase-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|395858312|ref|XP_003801515.1| PREDICTED: bifunctional polynucleotide phosphatase/kinase [Otolemur garnettii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 369 | ||||||
| UNIPROTKB|Q96T60 | 521 | PNKP "Bifunctional polynucleot | 0.712 | 0.504 | 0.420 | 2.1e-52 | |
| UNIPROTKB|F1N3Q9 | 522 | PNKP "Uncharacterized protein" | 0.712 | 0.503 | 0.424 | 2.7e-52 | |
| UNIPROTKB|E2R0U3 | 521 | PNKP "Uncharacterized protein" | 0.699 | 0.495 | 0.428 | 7.2e-52 | |
| UNIPROTKB|F1RHU1 | 522 | PNKP "Uncharacterized protein" | 0.712 | 0.503 | 0.424 | 9.2e-52 | |
| MGI|MGI:1891698 | 522 | Pnkp "polynucleotide kinase 3' | 0.699 | 0.494 | 0.424 | 1.2e-51 | |
| RGD|1303331 | 522 | Pnkp "polynucleotide kinase 3' | 0.699 | 0.494 | 0.424 | 1.3e-50 | |
| WB|WBGene00009010 | 407 | F21D5.5 [Caenorhabditis elegan | 0.742 | 0.673 | 0.367 | 2.6e-47 | |
| POMBASE|SPAC23C11.04c | 408 | pnk1 "DNA kinase/phosphatase P | 0.677 | 0.612 | 0.327 | 3e-30 | |
| DICTYBASE|DDB_G0281229 | 544 | pnkp "putative bifunctional po | 0.707 | 0.479 | 0.334 | 2.3e-28 | |
| GENEDB_PFALCIPARUM|PF13_0334 | 462 | PF13_0334 "polynucleotide kina | 0.943 | 0.753 | 0.263 | 6.8e-22 |
| UNIPROTKB|Q96T60 PNKP "Bifunctional polynucleotide phosphatase/kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 543 (196.2 bits), Expect = 2.1e-52, P = 2.1e-52
Identities = 114/271 (42%), Positives = 157/271 (57%)
Query: 5 WDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLK 64
W+ ++ KLLVFT+ V K+A FDLDGTLITT+SGKVFP DW++L+ I L+
Sbjct: 147 WENLE--KLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLR 204
Query: 65 QYLDDGYKLVIFTNQGAIGRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPG 124
+ +GYKLVIFTNQ +IGR K+ +F+AK E +++ L VP Q+ VAT YRKPV G
Sbjct: 205 ELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVATHAGLYRKPVTG 264
Query: 125 MWEYLSQEKNGDLAIDISQSFYXXXXXXXXXXXXP-KKKKDFACTDHXXXXXXXXXXXTP 183
MW++L ++ N I I S + P +KKKDF+C D TP
Sbjct: 265 MWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATP 324
Query: 184 EQIFLNEKAPDFPNLPTFKPREVYQKAQSQTIPN---IPHDKKQVLIMIGSQGSGKSSFV 240
E+ FL A F LP F PR V ++ +P + +V++ +G G+GKS+F+
Sbjct: 325 EEFFLKWPAAGF-ELPAFDPRTV-SRSGPLCLPESRALLSASPEVVVAVGFPGAGKSTFL 382
Query: 241 STYLKPLNYTTVNRDTLGSWQKCVSVMKAAL 271
+L Y VNRDTLGSWQ+CV+ + AL
Sbjct: 383 KKHLVSAGYVHVNRDTLGSWQRCVTTCETAL 413
|
|
| UNIPROTKB|F1N3Q9 PNKP "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0U3 PNKP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RHU1 PNKP "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1891698 Pnkp "polynucleotide kinase 3'- phosphatase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1303331 Pnkp "polynucleotide kinase 3'-phosphatase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009010 F21D5.5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC23C11.04c pnk1 "DNA kinase/phosphatase Pnk1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281229 pnkp "putative bifunctional polynucleotide phosphatase/kinase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF13_0334 PF13_0334 "polynucleotide kinase, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 369 | |||
| TIGR01663 | 526 | TIGR01663, PNK-3'Pase, polynucleotide 5'-kinase 3' | 1e-104 | |
| pfam08645 | 158 | pfam08645, PNK3P, Polynucleotide kinase 3 phosphat | 5e-70 | |
| TIGR01664 | 166 | TIGR01664, DNA-3'-Pase, DNA 3'-phosphatase | 3e-61 | |
| TIGR01662 | 132 | TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, | 2e-28 | |
| pfam13671 | 143 | pfam13671, AAA_33, AAA domain | 3e-23 | |
| COG0241 | 181 | COG0241, HisB, Histidinol phosphatase and related | 3e-17 | |
| TIGR01656 | 147 | TIGR01656, Histidinol-ppas, histidinol-phosphate p | 2e-08 | |
| PHA02530 | 300 | PHA02530, pseT, polynucleotide kinase; Provisional | 3e-07 | |
| TIGR04075 | 851 | TIGR04075, bacter_Pnkp, polynucleotide kinase-phos | 1e-06 | |
| TIGR01261 | 161 | TIGR01261, hisB_Nterm, histidinol-phosphatase | 5e-06 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 2e-05 | |
| COG4639 | 168 | COG4639, COG4639, Predicted kinase [General functi | 3e-05 | |
| PRK08942 | 181 | PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate p | 3e-05 | |
| TIGR00213 | 176 | TIGR00213, GmhB_yaeD, D,D-heptose 1,7-bisphosphate | 1e-04 | |
| PRK05446 | 354 | PRK05446, PRK05446, imidazole glycerol-phosphate d | 0.001 | |
| TIGR01681 | 128 | TIGR01681, HAD-SF-IIIC, HAD-superfamily phosphatas | 0.001 |
| >gnl|CDD|130724 TIGR01663, PNK-3'Pase, polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
Score = 316 bits (810), Expect = e-104
Identities = 149/374 (39%), Positives = 191/374 (51%), Gaps = 58/374 (15%)
Query: 2 KGSWDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIES 61
KG+ + KLL+FT+ V KIA FDLDGT+I TKSGKVFP DW+++F I
Sbjct: 145 KGNPGWENLEKLLIFTAAGVKGQEKIAGFDLDGTIIKTKSGKVFPKGPDDWQIIFPEIPE 204
Query: 62 VLKQYLDDGYKLVIFTNQGAIGRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKP 121
LK+ DG+K+ IFTNQG I R K++ DF+AK E I+ L VP Q+F+A YRKP
Sbjct: 205 KLKELEADGFKICIFTNQGGIARGKINADDFKAKIEAIVAKLGVPFQVFIAIGAGFYRKP 264
Query: 122 VPGMWEYLSQEKNGDLAIDISQSFYAGDAAGRAAN-WAP-KKKKDFACTDHLFAFNLNLA 179
+ GMW++L +E N I F+ GDAAGR AN A KKKKDF+C D LFA NL +
Sbjct: 265 LTGMWDHLKEEANDGTEIQEDDCFFVGDAAGRPANGKAAGKKKKDFSCADRLFAANLGIP 324
Query: 180 FFTPEQIFLNEKAPDFPNLPTFKPREVYQKAQSQTIPNIPHDKKQVLIMIGSQGSGKSSF 239
F TPE+ FL + A F P F PR V Q Q P D
Sbjct: 325 FATPEEFFLGKPAAGF-EKPAFDPRSV----QDQGPLCDPDDL----------------- 362
Query: 240 VSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALDS----VLIMIGSQGSGKSSFVSTYLKP 295
ALD ++I +G G+GKS F + +P
Sbjct: 363 ------------------------------ALDDAPCEMVIAVGFPGAGKSHFCKKFFQP 392
Query: 296 LNYTTVNRDTLGSWQKCVSVMKAALDSGLSVVVDNTNPDKESRHRYIEAAKQHGVRCIAV 355
Y VN DTLGS Q C++ + ALD G +DNTNPD SR ++++ A+ G+ C
Sbjct: 393 AGYKHVNADTLGSTQNCLTACERALDQGKRCAIDNTNPDAASRAKFLQCARAAGIPCRCF 452
Query: 356 HMNISKEHAKHNIK 369
N AKHNI
Sbjct: 453 LFNAPLAQAKHNIA 466
|
This model represents the metazoan 5'-polynucleotide-kinase-3'-phosphatase, PNKP, which is believed to be involved in repair of oxidative DNA damage. Removal of 3' phosphates is essential for the further processing of the break by DNA polymerases. The central phosphatase domain is a member of the IIIA subfamily (TIGR01662) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. As is common in this superfamily, the enzyme is magnesium dependent. A difference between this enzyme and other HAD-superfamily phosphatases is in the third conserved catalytic motif which usually contains two conserved aspartate residues believed to be involved in binding the magnesium ion. Here, the second aspartate is replaced by a conserved arginine residue which may indicate an interaction with the phosphate backbone of the substrate. Very close relatives of this domain are also found separate from the N- and C-terminal domains seen here, as in the 3'-phosphatase found in plants. The larger family of these domains is described by TIGR01664. Outside of the phosphatase domain is a P-loop ATP-binding motif associated with the kinase activity. The entry for the mouse homolog, GP|7108591, appears to be missing a large piece of sequence corresponding to the first conserved catalytic motif of the phosphatase domain as well as the conserved threonine of the second motif. Either this is a sequencing artifact or this may represent a pseudo- or non-functional gene. Note that the EC number for the kinase function is: 2.7.1.78. Length = 526 |
| >gnl|CDD|219952 pfam08645, PNK3P, Polynucleotide kinase 3 phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|211680 TIGR01664, DNA-3'-Pase, DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >gnl|CDD|222307 pfam13671, AAA_33, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|223319 COG0241, HisB, Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233512 TIGR01656, Histidinol-ppas, histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >gnl|CDD|222856 PHA02530, pseT, polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|130328 TIGR01261, hisB_Nterm, histidinol-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|226986 COG4639, COG4639, Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236354 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|129317 TIGR00213, GmhB_yaeD, D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|235471 PRK05446, PRK05446, imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233526 TIGR01681, HAD-SF-IIIC, HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 369 | |||
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 100.0 | |
| KOG2134|consensus | 422 | 100.0 | ||
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 100.0 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 100.0 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 99.97 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 99.94 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 99.94 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 99.9 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 99.9 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 99.86 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 99.83 | |
| PRK06769 | 173 | hypothetical protein; Validated | 99.81 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 99.72 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 99.71 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 99.71 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 99.7 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 99.7 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 99.69 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 99.69 | |
| COG4639 | 168 | Predicted kinase [General function prediction only | 99.69 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 99.68 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 99.68 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 99.68 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 99.67 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 99.66 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 99.66 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 99.65 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 99.65 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 99.64 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 99.64 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 99.63 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 99.63 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 99.63 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 99.62 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 99.61 | |
| PLN02940 | 382 | riboflavin kinase | 99.61 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 99.6 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 99.6 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 99.59 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 99.59 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 99.59 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 99.58 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.58 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.57 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 99.57 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 99.55 | |
| COG0645 | 170 | Predicted kinase [General function prediction only | 99.54 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.54 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 99.53 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 99.53 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 99.53 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 99.52 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 99.52 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 99.52 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 99.51 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 99.5 | |
| KOG3085|consensus | 237 | 99.5 | ||
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.48 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 99.48 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 99.47 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 99.46 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 99.46 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 99.46 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 99.46 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.46 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.45 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 99.44 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.44 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 99.43 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 99.43 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.42 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 99.4 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 99.4 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 99.4 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 99.39 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 99.39 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.38 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 99.38 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 99.37 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 99.36 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 99.36 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 99.34 | |
| PLN02811 | 220 | hydrolase | 99.33 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 99.32 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 99.31 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 99.3 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 99.27 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.26 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 99.26 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.26 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 99.25 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 99.23 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.23 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 99.23 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 99.21 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.21 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.21 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 99.21 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 99.21 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 99.2 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.19 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 99.19 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 99.19 | |
| KOG2882|consensus | 306 | 99.19 | ||
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 99.18 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 99.16 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 99.16 | |
| PF01591 | 222 | 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 | 99.15 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 99.14 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.13 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 99.13 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 99.11 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 99.1 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 99.08 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 99.08 | |
| KOG0635|consensus | 207 | 99.07 | ||
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 99.06 | |
| KOG3354|consensus | 191 | 99.06 | ||
| PRK07261 | 171 | topology modulation protein; Provisional | 99.04 | |
| PRK06217 | 183 | hypothetical protein; Validated | 99.04 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 99.03 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 99.02 | |
| PLN02200 | 234 | adenylate kinase family protein | 99.0 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 98.99 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 98.99 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 98.99 | |
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 98.95 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 98.94 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.93 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 98.92 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 98.92 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 98.91 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 98.9 | |
| KOG3040|consensus | 262 | 98.9 | ||
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.9 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 98.89 | |
| PLN02674 | 244 | adenylate kinase | 98.88 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 98.87 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 98.85 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 98.85 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 98.85 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 98.84 | |
| KOG2914|consensus | 222 | 98.83 | ||
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 98.83 | |
| PRK08238 | 479 | hypothetical protein; Validated | 98.83 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 98.83 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 98.82 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 98.82 | |
| KOG3109|consensus | 244 | 98.81 | ||
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 98.8 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 98.8 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 98.79 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 98.79 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 98.79 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 98.79 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 98.78 | |
| KOG3062|consensus | 281 | 98.78 | ||
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 98.78 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 98.77 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 98.77 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 98.77 | |
| PRK03839 | 180 | putative kinase; Provisional | 98.76 | |
| KOG3079|consensus | 195 | 98.73 | ||
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 98.73 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 98.73 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 98.71 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.71 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 98.7 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 98.68 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 98.67 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 98.66 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.66 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 98.6 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 98.6 | |
| PLN02459 | 261 | probable adenylate kinase | 98.59 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 98.59 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 98.59 | |
| PLN02199 | 303 | shikimate kinase | 98.58 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 98.57 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 98.54 | |
| PF08303 | 168 | tRNA_lig_kinase: tRNA ligase kinase domain; InterP | 98.54 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 98.53 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 98.53 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.48 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 98.47 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 98.41 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 98.4 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 98.4 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 98.4 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 98.39 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.39 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 98.38 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 98.37 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 98.37 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 98.36 | |
| KOG4622|consensus | 291 | 98.35 | ||
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 98.35 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 98.34 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 98.33 | |
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 98.33 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 98.3 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 98.3 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.3 | |
| COG3896 | 205 | Chloramphenicol 3-O-phosphotransferase [Defense me | 98.29 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 98.29 | |
| PRK06696 | 223 | uridine kinase; Validated | 98.28 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 98.28 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 98.27 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 98.27 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 98.25 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 98.24 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 98.23 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 98.23 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 98.22 | |
| KOG4238|consensus | 627 | 98.21 | ||
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 98.21 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 98.21 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 98.2 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 98.19 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 98.18 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 98.17 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 98.17 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 98.14 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 98.12 | |
| PRK07667 | 193 | uridine kinase; Provisional | 98.12 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 98.11 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 98.11 | |
| PLN02842 | 505 | nucleotide kinase | 98.1 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 98.1 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 98.1 | |
| PLN02924 | 220 | thymidylate kinase | 98.08 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 98.08 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 98.07 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 98.05 | |
| KOG3347|consensus | 176 | 98.04 | ||
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 98.04 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 98.02 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 97.98 | |
| KOG1615|consensus | 227 | 97.98 | ||
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 97.97 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 97.96 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 97.96 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 97.96 | |
| PLN02422 | 232 | dephospho-CoA kinase | 97.94 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 97.94 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 97.92 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 97.91 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 97.89 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 97.89 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 97.87 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 97.87 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 97.85 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.84 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 97.84 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 97.84 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 97.83 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 97.82 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 97.76 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.75 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 97.75 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 97.73 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 97.71 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 97.71 | |
| PLN02772 | 398 | guanylate kinase | 97.71 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.71 | |
| KOG0234|consensus | 438 | 97.7 | ||
| COG1660 | 286 | Predicted P-loop-containing kinase [General functi | 97.7 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 97.69 | |
| PRK13974 | 212 | thymidylate kinase; Provisional | 97.69 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.69 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 97.68 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 97.68 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 97.63 | |
| PLN02348 | 395 | phosphoribulokinase | 97.62 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 97.62 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 97.6 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.57 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 97.56 | |
| TIGR00174 | 287 | miaA tRNA isopentenyltransferase (miaA). Catalyzes | 97.55 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 97.55 | |
| KOG1384|consensus | 348 | 97.54 | ||
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 97.54 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 97.51 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 97.51 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.5 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 97.5 | |
| KOG2961|consensus | 190 | 97.49 | ||
| PF13173 | 128 | AAA_14: AAA domain | 97.47 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 97.46 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 97.45 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 97.45 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.45 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 97.4 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.39 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 97.39 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 97.39 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.38 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 97.37 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 97.37 | |
| COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 97.37 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 97.36 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.35 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 97.35 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.35 | |
| KOG3308|consensus | 225 | 97.34 | ||
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 97.34 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.34 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 97.33 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 97.33 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 97.32 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.3 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 97.3 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 97.3 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 97.29 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 97.29 | |
| KOG0744|consensus | 423 | 97.29 | ||
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 97.29 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 97.28 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 97.28 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 97.27 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.27 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 97.26 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 97.26 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 97.26 | |
| KOG3877|consensus | 393 | 97.23 | ||
| PTZ00174 | 247 | phosphomannomutase; Provisional | 97.23 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 97.22 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.21 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 97.2 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 97.2 | |
| KOG3220|consensus | 225 | 97.19 | ||
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 97.18 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.16 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.16 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.14 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.14 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.13 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 97.13 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 97.12 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 97.12 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.11 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 97.1 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 97.08 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.08 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 97.08 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.08 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 97.06 | |
| KOG1532|consensus | 366 | 97.03 | ||
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.02 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 97.02 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 97.01 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 97.0 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.99 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.98 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 96.97 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 96.97 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.96 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 96.96 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.95 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 96.94 | |
| KOG0780|consensus | 483 | 96.94 | ||
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.93 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 96.92 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 96.92 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.92 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 96.91 | |
| KOG1969|consensus | 877 | 96.9 | ||
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.89 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.89 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.88 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 96.88 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 96.87 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 96.87 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.86 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.86 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 96.86 | |
| PLN02887 | 580 | hydrolase family protein | 96.86 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.85 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.85 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 96.85 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 96.83 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 96.82 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 96.81 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.81 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.81 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.81 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 96.8 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 96.8 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 96.79 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.79 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.79 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 96.76 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 96.75 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 96.75 | |
| KOG1533|consensus | 290 | 96.74 | ||
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 96.73 | |
| PHA02244 | 383 | ATPase-like protein | 96.73 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 96.73 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 96.72 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 96.72 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 96.71 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.68 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.68 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 96.68 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 96.67 | |
| PRK13768 | 253 | GTPase; Provisional | 96.67 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 96.66 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.64 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.63 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 96.61 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 96.6 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.6 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 96.6 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 96.59 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.59 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.58 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 96.58 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 96.58 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 96.58 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.57 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.57 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 96.56 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 96.55 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 96.54 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 96.53 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 96.53 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 96.52 | |
| KOG3078|consensus | 235 | 96.52 | ||
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.52 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 96.52 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 96.51 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 96.51 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 96.5 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 96.5 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.5 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.48 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.47 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 96.47 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 96.46 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 96.46 | |
| KOG0739|consensus | 439 | 96.46 | ||
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 96.46 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 96.46 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 96.45 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 96.45 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 96.45 | |
| KOG0730|consensus | 693 | 96.44 | ||
| COG3709 | 192 | Uncharacterized component of phosphonate metabolis | 96.43 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 96.43 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 96.42 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 96.42 | |
| KOG0733|consensus | 802 | 96.42 | ||
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 96.41 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 96.41 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 96.41 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 96.4 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 96.39 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 96.39 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.39 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 96.38 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 96.38 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.38 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 96.37 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 96.36 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 96.35 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 96.33 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.33 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 96.32 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 96.32 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.3 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 96.28 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 96.28 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.28 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 96.27 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 96.26 | |
| PLN02423 | 245 | phosphomannomutase | 96.26 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.24 | |
| KOG3120|consensus | 256 | 96.23 | ||
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 96.22 | |
| PF05729 | 166 | NACHT: NACHT domain | 96.21 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 96.21 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.2 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 96.2 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.18 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 96.18 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 96.18 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.17 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 96.17 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.17 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 96.17 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 96.16 | |
| PRK08181 | 269 | transposase; Validated | 96.16 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 96.16 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 96.16 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 96.16 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.15 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 96.14 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.14 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 96.13 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 96.13 |
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-69 Score=548.59 Aligned_cols=317 Identities=44% Similarity=0.781 Sum_probs=289.2
Q ss_pred CCcEEecCceEEEEecCCCCCCceEEEEecCCceeecCCCCCCCCCccccccccccHHHHHHHHHHCCcEEEEEecCCCc
Q psy4598 3 GSWDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLKQYLDDGYKLVIFTNQGAI 82 (369)
Q Consensus 3 ~~W~~~~~~~~~~~~~~~~~~~~k~~~fDlDgTLi~~~sg~~~~~~~~d~~~~~p~v~~~L~~L~~~G~~i~i~TNq~gi 82 (369)
..|+.++ +|++|+..++..+.|+++||||||||.++||..|+.+++||+++||+|+++|++|+++||+|+|+|||+|+
T Consensus 148 ~~w~~~~--~~~~~~~~~~~~~~Kia~fD~DGTLi~t~sg~~~~~~~~d~~~l~pgV~e~L~~L~~~Gy~IvIvTNQ~gI 225 (526)
T TIGR01663 148 PGWENLE--KLLIFTAAGVKGQEKIAGFDLDGTIIKTKSGKVFPKGPDDWQIIFPEIPEKLKELEADGFKICIFTNQGGI 225 (526)
T ss_pred ccccccC--ceEEEecCCcCccCcEEEEECCCCccccCCCccCCCCHHHeeecccCHHHHHHHHHHCCCEEEEEECCccc
Confidence 3688886 68999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCHHHHHHHHHHHHHHcCCCeEEEEecCCCCCCCCchhHHHHHHHHhcCCccccCCccEEeeCccccccc-cCCCC
Q psy4598 83 GRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPGMWEYLSQEKNGDLAIDISQSFYAGDAAGRAAN-WAPKK 161 (369)
Q Consensus 83 ~~~~~~~~~~~~~i~~~l~~l~i~~~~~~~~~~~~~rKP~~gm~~~~~~~~~~~~~i~~~~s~~VGD~~gr~~~-~~~~~ 161 (369)
++|+++.++++.++..+++.+|++|++++|++.+.||||+||||++++++++.++++++++||||||++||+.. |.+++
T Consensus 226 ~~G~~~~~~~~~ki~~iL~~lgipfdviia~~~~~~RKP~pGm~~~a~~~~~~~~~Id~~~S~~VGDaagr~~~g~~ag~ 305 (526)
T TIGR01663 226 ARGKINADDFKAKIEAIVAKLGVPFQVFIAIGAGFYRKPLTGMWDHLKEEANDGTEIQEDDCFFVGDAAGRPANGKAAGK 305 (526)
T ss_pred ccCcccHHHHHHHHHHHHHHcCCceEEEEeCCCCCCCCCCHHHHHHHHHhcCcccCCCHHHeEEeCCcccchHHHHhcCC
Confidence 99999999999999999999999999999999999999999999999999876678999999999999999865 66654
Q ss_pred -CCCCCcccHHHHHhCCCCccCchhhccCCCCCCCCCCCCCCcchhccccccCCCCCCCCCCceEEEEEcCCCCCcchhh
Q psy4598 162 -KKDFACTDHLFAFNLNLAFFTPEQIFLNEKAPDFPNLPTFKPREVYQKAQSQTIPNIPHDKKQVLIMIGSQGSGKSSFV 240 (369)
Q Consensus 162 -~~d~s~~D~~~A~n~Gi~f~~pe~~f~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~i~v~~g~~~~gks~~~ 240 (369)
+|||||+|++||.|+||+|+||||||+++++.++ ..|+|+|+.+.+..+... ++
T Consensus 306 ~~~D~s~~D~~FA~n~gi~F~tPee~Fl~~~~~~~-~~~~f~p~~~~~~~~~~~----------------~~-------- 360 (526)
T TIGR01663 306 KKKDFSCADRLFAANLGIPFATPEEFFLGKPAAGF-EKPAFDPRSVQDQGPLCD----------------PD-------- 360 (526)
T ss_pred CcCCCChhhHHHHHHcCCcccChHHHhCCCCcccc-cccCCCchhhcccccccC----------------Cc--------
Confidence 7999999999999999999999999999999888 789999988754321110 00
Q ss_pred hhccCCCcccccccccccchhhhhhhccccccEEEEEEcCCCCcHHHHHHHHhccCCcEEEeCCcchhHHHHHHHHHHHH
Q psy4598 241 STYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRDTLGSWQKCVSVMKAAL 320 (369)
Q Consensus 241 ~~~~~~~~~~~i~r~~~~~~~~~~~~~~~~~~~lIll~G~pGSGKSTla~~L~~~~~~~~i~~D~~~~~~~~~~~~~~~l 320 (369)
.. ...+.+|.+|+|+|+|||||||+|+++++..++.+|++|.++.|+.|...++++|
T Consensus 361 -------~~----------------~~~~~~p~LVil~G~pGSGKST~A~~l~~~~g~~~vn~D~lg~~~~~~~~a~~~L 417 (526)
T TIGR01663 361 -------DL----------------ALDDAPCEMVIAVGFPGAGKSHFCKKFFQPAGYKHVNADTLGSTQNCLTACERAL 417 (526)
T ss_pred -------cc----------------ccCCCCceEEEEECCCCCCHHHHHHHHHHHcCCeEECcHHHHHHHHHHHHHHHHH
Confidence 00 0123457899999999999999999999999999999999999999999999999
Q ss_pred hCCCcEEEeCCCCCHHHHHHHHHHHHhcCCeEEEEEEeCCHHHHHHHcC
Q psy4598 321 DSGLSVVVDNTNPDKESRHRYIEAAKQHGVRCIAVHMNISKEHAKHNIK 369 (369)
Q Consensus 321 ~~g~~vIiD~tn~~~~~r~~~~~la~~~~~~v~~v~l~~~~e~~~~Rn~ 369 (369)
+.|.+||||+||.+++.|..|+++|+++|+++++++|++|.++|++||+
T Consensus 418 ~~G~sVVIDaTn~~~~~R~~~i~lAk~~gv~v~~i~~~~p~e~~~~Rn~ 466 (526)
T TIGR01663 418 DQGKRCAIDNTNPDAASRAKFLQCARAAGIPCRCFLFNAPLAQAKHNIA 466 (526)
T ss_pred hCCCcEEEECCCCCHHHHHHHHHHHHHcCCeEEEEEeCCCHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999984
|
Note that the EC number for the kinase function is: 2.7.1.78 |
| >KOG2134|consensus | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >COG4639 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG0645 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3085|consensus | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >KOG2882|consensus | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0635|consensus | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >KOG3354|consensus | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3040|consensus | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2914|consensus | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3109|consensus | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >KOG3062|consensus | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3079|consensus | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >KOG4622|consensus | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4238|consensus | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1615|consensus | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG0234|consensus | Back alignment and domain information |
|---|
| >COG1660 Predicted P-loop-containing kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >PRK13974 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR00174 miaA tRNA isopentenyltransferase (miaA) | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >KOG1384|consensus | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >KOG2961|consensus | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG3308|consensus | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3877|consensus | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3220|consensus | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >KOG1532|consensus | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >KOG0780|consensus | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1969|consensus | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >KOG3078|consensus | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG3120|consensus | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 369 | ||||
| 3zvl_A | 416 | The Structural Basis For Substrate Recognition By M | 3e-62 | ||
| 3zvm_A | 416 | The Structural Basis For Substrate Recognition By M | 4e-62 | ||
| 3zvn_A | 416 | The Structural Basis For Substrate Recognition By M | 9e-62 | ||
| 1yj5_A | 383 | Molecular Architecture Of Mammalian Polynucleotide | 2e-61 | ||
| 3u7e_B | 381 | Crystal Structure Of Mpnkp Catalytic Fragment (D170 | 7e-61 | ||
| 3u7g_A | 379 | Crystal Structure Of Mpnkp Catalytic Fragment (D170 | 1e-60 |
| >pdb|3ZVL|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
|
| >pdb|3ZVM|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
| >pdb|3ZVN|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
| >pdb|1YJ5|A Chain A, Molecular Architecture Of Mammalian Polynucleotide Kinase, A Dna Repair Enzyme Length = 383 | Back alignment and structure |
| >pdb|3U7E|B Chain B, Crystal Structure Of Mpnkp Catalytic Fragment (D170a) Length = 381 | Back alignment and structure |
| >pdb|3U7G|A Chain A, Crystal Structure Of Mpnkp Catalytic Fragment (D170a) Bound To Single- Stranded Dna (Tcctap) Length = 379 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 369 | |||
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 6e-84 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 3e-19 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 2e-15 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 2e-14 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 6e-13 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 2e-12 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 6e-11 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 1e-10 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 3e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 2e-07 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 1e-05 |
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Length = 416 | Back alignment and structure |
|---|
Score = 260 bits (664), Expect = 6e-84
Identities = 148/370 (40%), Positives = 196/370 (52%), Gaps = 51/370 (13%)
Query: 1 MKGSWDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIE 60
W+ + KLLVFT++ V K+A+FDLDGTLITT+SGKVFP DW++L+ I
Sbjct: 36 SSLGWESLK--KLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIP 93
Query: 61 SVLKQYLDDGYKLVIFTNQGAIGRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRK 120
L++ +GYKLVIFTNQ IGR K+ F+ K E +++ L VP Q+ VAT RK
Sbjct: 94 KKLQELAAEGYKLVIFTNQMGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVATHAGLNRK 153
Query: 121 PVPGMWEYLSQEKNGDLAIDISQSFYAGDAAGRAANWAP-KKKKDFACTDHLFAFNLNLA 179
PV GMW++L ++ N + I + S + GDAAGR ANWAP +KKKDF+C D LFA N+ L
Sbjct: 154 PVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLP 213
Query: 180 FFTPEQIFLNEKAPDFPNLPTFKPREVYQKAQSQTIPNIPHDKKQVLIMIGSQGSGKSSF 239
F TPE+ FL A F P F PR + + ++
Sbjct: 214 FATPEEFFLKWPAARFEL-PAFDPRTISSAGPLYLPESSSLLSPNPEVV----------- 261
Query: 240 VSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSVLIMIGSQGSGKSSFVSTYLKPLNYT 299
+ +G G+GKS+F+ +L Y
Sbjct: 262 ------------------------------------VAVGFPGAGKSTFIQEHLVSAGYV 285
Query: 300 TVNRDTLGSWQKCVSVMKAALDSGLSVVVDNTNPDKESRHRYIEAAKQHGVRCIAVHMNI 359
VNRDTLGSWQ+CVS +AAL G VV+DNTNPD SR RYI+ AK GV C +
Sbjct: 286 HVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCA 345
Query: 360 SKEHAKHNIK 369
+ E A+HN +
Sbjct: 346 TIEQARHNNR 355
|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Length = 179 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Length = 176 | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Length = 211 | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Length = 218 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Length = 287 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 369 | |||
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 100.0 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 99.9 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.89 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.84 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 99.81 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 99.8 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.76 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 99.75 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 99.71 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 99.67 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 99.66 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.63 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.61 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.61 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 99.61 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.6 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.6 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.6 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 99.6 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.6 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.59 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.59 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.58 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.58 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.58 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 99.58 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 99.58 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 99.56 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.56 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.55 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.55 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 99.55 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.55 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.55 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.54 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 99.54 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 99.53 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.53 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.53 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.52 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.52 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.51 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.51 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.51 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.51 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.51 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.51 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 99.51 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.51 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 99.5 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.5 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.48 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 99.48 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.48 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.48 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 99.46 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.46 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.46 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.46 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.45 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.45 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.45 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.45 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.44 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 99.44 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.44 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 99.43 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.43 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.43 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.42 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 99.41 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.41 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 99.41 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.41 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.4 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.4 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 99.39 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.39 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.38 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.38 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.38 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 99.38 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.37 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.37 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.36 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.35 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.35 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.35 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 99.34 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.34 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.34 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 99.34 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 99.34 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 99.32 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 99.32 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.31 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 99.31 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 99.31 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 99.3 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.29 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 99.27 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.26 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.26 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 99.25 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 99.25 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 99.24 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 99.24 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.24 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 99.24 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 99.24 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 99.23 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 99.23 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.22 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.22 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 99.2 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 99.2 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 99.2 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 99.2 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 99.18 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.17 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 99.16 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 99.13 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.13 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.13 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 99.12 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 99.11 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 99.1 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 99.1 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 99.1 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 99.1 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 99.1 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 99.1 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 99.09 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 99.07 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 99.06 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 99.06 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 99.05 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 99.05 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 99.03 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 99.02 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 99.01 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 99.01 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 99.01 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 98.99 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 98.97 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 98.96 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 98.94 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 98.94 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 98.94 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 98.94 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 98.93 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 98.92 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 98.91 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 98.91 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 98.89 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 98.86 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 98.86 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 98.84 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 98.84 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 98.82 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 98.82 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 98.81 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 98.8 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 98.78 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 98.78 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 98.76 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 98.72 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 98.69 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 98.69 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 98.69 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 98.69 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 98.68 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 98.66 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 98.66 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 98.65 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 98.65 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 98.65 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 98.64 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 98.63 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 98.62 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 98.62 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 98.61 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 98.58 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 98.58 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 98.57 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 98.57 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 98.55 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 98.54 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 98.53 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 98.52 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 98.5 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 98.49 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 98.49 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 98.48 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 98.46 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 98.45 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 98.45 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 98.43 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 98.39 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 98.38 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 98.36 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 98.36 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 98.35 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.35 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 98.32 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 98.29 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 98.27 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 98.26 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 98.25 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 98.25 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 98.24 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 98.21 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 98.2 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 97.51 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 98.19 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 98.18 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 98.17 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 98.16 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 98.15 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 98.08 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 98.07 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 98.03 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 98.02 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 98.01 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 98.01 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.99 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 97.97 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 97.95 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 97.94 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 97.93 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.93 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.91 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 97.9 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 97.9 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 97.89 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 97.84 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 97.79 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.79 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.78 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 97.76 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 97.73 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 97.7 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 97.66 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 97.56 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.49 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.49 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 97.49 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 97.48 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.47 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 97.46 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 97.44 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 97.42 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.41 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 97.4 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 97.36 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.33 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 97.33 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.3 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.29 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.29 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 97.24 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 97.21 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 97.2 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 97.19 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.11 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 97.1 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 97.1 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.09 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.08 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 97.07 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.06 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 97.05 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 97.05 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 97.03 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.01 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.0 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.0 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 96.99 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.98 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.98 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 96.98 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.96 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.95 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.92 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.9 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.9 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.88 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 96.88 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.87 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.86 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 96.86 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 96.81 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.79 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 96.78 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 96.75 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 96.73 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 96.73 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 96.72 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 96.72 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 96.69 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 96.68 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 96.66 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.66 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 96.65 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.64 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.64 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 96.63 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.63 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 96.62 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.58 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 96.58 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.57 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.56 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.56 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.55 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.54 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 96.51 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.49 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.48 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.47 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 96.46 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.44 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 96.44 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.43 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 96.42 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.39 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.39 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 96.38 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.37 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 96.34 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 96.33 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 96.33 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 96.32 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 96.31 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 96.29 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.29 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 96.27 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.25 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 96.25 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.24 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.22 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.21 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 96.19 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.19 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 96.17 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 96.17 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.17 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 96.17 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.14 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 96.14 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.14 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.12 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 96.1 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.08 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 96.08 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.07 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 96.07 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 96.06 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 96.05 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.04 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 96.04 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 96.04 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.03 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.0 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 95.97 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.97 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.96 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 95.96 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.95 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 95.95 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.95 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 95.94 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 95.93 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 95.93 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 95.93 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 95.91 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 95.91 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 95.9 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 95.89 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 95.87 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 95.85 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 95.84 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 95.84 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 95.84 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.84 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.82 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 95.82 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.77 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 95.77 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.77 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 95.76 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 95.72 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 95.69 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 95.65 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 95.64 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 95.6 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 95.58 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.58 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 95.58 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 95.56 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.52 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 95.45 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.45 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 95.43 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 95.42 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 95.42 | |
| 4g63_A | 470 | Cytosolic IMP-GMP specific 5'-nucleotidase; struct | 95.41 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 95.41 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 95.4 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 95.38 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 95.38 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.37 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 95.34 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 95.33 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.33 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 95.29 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 95.29 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 95.24 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.23 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 95.22 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 95.18 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.17 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.17 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 95.1 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 95.08 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.07 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 95.05 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.04 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 95.03 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 95.02 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 94.98 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 94.98 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 94.98 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 94.93 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 94.87 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 94.86 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 94.86 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 94.82 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.81 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 94.81 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 94.79 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 94.77 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 94.77 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 94.75 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 94.69 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 94.69 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 94.69 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 94.69 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 94.68 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 94.67 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 94.66 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 94.65 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 94.64 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 94.63 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 94.62 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 94.62 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 94.6 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 94.59 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 94.59 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.58 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 94.56 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 94.51 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 94.5 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 94.5 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 94.49 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.49 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 94.48 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 94.47 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 94.46 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 94.44 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 94.39 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 94.39 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 94.35 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 94.34 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 94.32 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 94.3 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 94.27 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 94.26 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 94.26 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 94.24 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 94.23 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 94.23 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 94.2 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 94.2 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 94.18 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 94.17 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 94.15 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 94.13 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 94.1 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 94.06 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 94.03 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 94.0 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 93.98 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 93.97 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 93.96 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 93.95 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 93.92 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 93.92 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 93.91 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 93.88 |
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=7.1e-60 Score=470.59 Aligned_cols=316 Identities=48% Similarity=0.818 Sum_probs=287.5
Q ss_pred CCcEEecCceEEEEecCCCCCCceEEEEecCCceeecCCCCCCCCCccccccccccHHHHHHHHHHCCcEEEEEecCCCc
Q psy4598 3 GSWDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLKQYLDDGYKLVIFTNQGAI 82 (369)
Q Consensus 3 ~~W~~~~~~~~~~~~~~~~~~~~k~~~fDlDgTLi~~~sg~~~~~~~~d~~~~~p~v~~~L~~L~~~G~~i~i~TNq~gi 82 (369)
..|+.++ ++++|+.+.+..+.|+++||+||||+.+.+|..|.....+|.+++||+.++|+.|+++||+++|+|||+|+
T Consensus 38 ~~W~~~~--~~~~~~~~~~~~~~k~v~fD~DGTL~~~~~~~~~~~~~~~~~~~~pgv~e~L~~L~~~G~~l~IvTN~~gi 115 (416)
T 3zvl_A 38 LGWESLK--KLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKLVIFTNQMGI 115 (416)
T ss_dssp CEEEEET--TEEEEECTTCCCCSSEEEECSBTTTEECSSCSSSCSSTTCCEESCTTHHHHHHHHHHTTCEEEEEEECHHH
T ss_pred cCceecC--cEEEecCCCCCCCCeEEEEeCCCCccccCCCccCCCCHHHhhhhcccHHHHHHHHHHCCCeEEEEeCCccc
Confidence 4599998 47999999999999999999999999999888999999999989999999999999999999999999999
Q ss_pred CCCCCCHHHHHHHHHHHHHHcCCCeEEEEecCCCCCCCCchhHHHHHHHHhcCCccccCCccEEeeCccccccccCCC-C
Q psy4598 83 GRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPGMWEYLSQEKNGDLAIDISQSFYAGDAAGRAANWAPK-K 161 (369)
Q Consensus 83 ~~~~~~~~~~~~~i~~~l~~l~i~~~~~~~~~~~~~rKP~~gm~~~~~~~~~~~~~i~~~~s~~VGD~~gr~~~~~~~-~ 161 (369)
++|+++...+..++..+++.+|++|++++|++++.++||+|+||+.++++++.++++++++|+||||++||+++|.++ +
T Consensus 116 ~~g~~~~~~~~~~~~~~l~~lgl~fd~i~~~~~~~~~KP~p~~~~~a~~~l~~~~~v~~~~~l~VGDs~gr~~~~~~~~~ 195 (416)
T 3zvl_A 116 GRGKLPAEVFKGKVEAVLEKLGVPFQVLVATHAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRK 195 (416)
T ss_dssp HTTSSCHHHHHHHHHHHHHHHTSCCEEEEECSSSTTSTTSSHHHHHHHHHSSTTCCCCGGGCEEECSCSCBCTTSSTTCC
T ss_pred cCCCCCHHHHHHHHHHHHHHcCCCEEEEEECCCCCCCCCCHHHHHHHHHHhCCCCCCCHHHeEEEECCCCCccccccccc
Confidence 999999999999999999999999999999999999999999999999997655569999999999999999999984 6
Q ss_pred CCCCCcccHHHHHhCCCCccCchhhccCCCCCCCCCCCCCCcchhccccccCCCCCCCCCCceEEEEEcCCCCCcchhhh
Q psy4598 162 KKDFACTDHLFAFNLNLAFFTPEQIFLNEKAPDFPNLPTFKPREVYQKAQSQTIPNIPHDKKQVLIMIGSQGSGKSSFVS 241 (369)
Q Consensus 162 ~~d~s~~D~~~A~n~Gi~f~~pe~~f~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~i~v~~g~~~~gks~~~~ 241 (369)
|||||++|+++|+|+||+|++||+||++++..+| .+|+|+|+.+....+.+. |.++
T Consensus 196 ~~d~s~~Di~~A~~aGi~f~~pe~~f~~~~~~~~-~~~~f~p~~~~~~~~~~~-----------------p~~~------ 251 (416)
T 3zvl_A 196 KKDFSCADRLFALNVGLPFATPEEFFLKWPAARF-ELPAFDPRTISSAGPLYL-----------------PESS------ 251 (416)
T ss_dssp SCCSCCHHHHHHHHHTCCEECHHHHHSCCCCCCB-CCCSCCGGGCCSCSCSSB-----------------STTS------
T ss_pred ccCCChhhHHHHHHcCCcccCcHHhhCCCCcCcc-ccCCCChhhhcccccccC-----------------CCcc------
Confidence 9999999999999999999999999999998888 789999988754332210 0000
Q ss_pred hccCCCcccccccccccchhhhhhhccccccEEEEEEcCCCCcHHHHHHHHhccCCcEEEeCCcchhHHHHHHHHHHHHh
Q psy4598 242 TYLKPLNYTTVNRDTLGSWQKCVSVMKAALDSVLIMIGSQGSGKSSFVSTYLKPLNYTTVNRDTLGSWQKCVSVMKAALD 321 (369)
Q Consensus 242 ~~~~~~~~~~i~r~~~~~~~~~~~~~~~~~~~lIll~G~pGSGKSTla~~L~~~~~~~~i~~D~~~~~~~~~~~~~~~l~ 321 (369)
....+.+.+|+|+|+|||||||+++.|++.+++.+|+.|.++.|+.+...+..++.
T Consensus 252 ------------------------~~~~~~~~lIil~G~pGSGKSTla~~L~~~~~~~~i~~D~~~~~~~~~~~~~~~l~ 307 (416)
T 3zvl_A 252 ------------------------SLLSPNPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALR 307 (416)
T ss_dssp ------------------------CSCCSSCCEEEEESCTTSSHHHHHHHHTGGGTCEECCGGGSCSHHHHHHHHHHHHH
T ss_pred ------------------------ccCCCCCEEEEEECCCCCCHHHHHHHHHHhcCcEEEccchHHHHHHHHHHHHHHHh
Confidence 01123457899999999999999999999999999999999999999999999999
Q ss_pred CCCcEEEeCCCCCHHHHHHHHHHHHhcCCeEEEEEEeCCHHHHHHHc
Q psy4598 322 SGLSVVVDNTNPDKESRHRYIEAAKQHGVRCIAVHMNISKEHAKHNI 368 (369)
Q Consensus 322 ~g~~vIiD~tn~~~~~r~~~~~la~~~~~~v~~v~l~~~~e~~~~Rn 368 (369)
.|.+||+|+++.....|..++++++++++.+.+|++++|.+++++|+
T Consensus 308 ~g~~vIiD~~~~~~~~r~~~~~~~~~~~~~~~~v~l~~~~e~l~~R~ 354 (416)
T 3zvl_A 308 QGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNN 354 (416)
T ss_dssp TTCCEEEESCCCSHHHHHHHHHHHHHHTCCEEEEEECCCHHHHHHHH
T ss_pred cCCcEEEeCCCCCHHHHHHHHHHHHHcCCeEEEEEEeCCHHHHHHHH
Confidence 99999999999999999999999999999999999999999999996
|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 369 | ||||
| d1yj5a1 | 195 | c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' | 4e-58 | |
| d1yj5a2 | 172 | c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p | 4e-17 | |
| d1ltqa1 | 149 | c.108.1.9 (A:153-301) Polynucleotide kinase, phosp | 1e-06 | |
| d2fpwa1 | 161 | c.108.1.19 (A:3-163) Histidine biosynthesis bifunc | 5e-06 | |
| d1ly1a_ | 152 | c.37.1.1 (A:) Polynucleotide kinase, kinase domain | 0.003 |
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 195 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: phosphatase domain of polynucleotide kinase domain: 5' polynucleotide kinase-3' phosphatase, middle domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 185 bits (470), Expect = 4e-58
Identities = 99/196 (50%), Positives = 129/196 (65%), Gaps = 4/196 (2%)
Query: 5 WDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLK 64
W+ + KLLVFT++ V K+A+FDLDGTLITT+SGKVFP DW++L+ I L+
Sbjct: 3 WESLK--KLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQ 60
Query: 65 QYLDDGYKLVIFTNQGAIGRKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPG 124
+ +GYKLVIFTNQ IGR K+ F+ K E +++ L VP Q+ VAT RKPV G
Sbjct: 61 ELAAEGYKLVIFTNQMGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVATHAGLNRKPVSG 120
Query: 125 MWEYLSQEKNGDLAIDISQSFYAGDAAGRAANWAP-KKKKDFACTDHLFAFNLNLAFFTP 183
MW++L ++ N + I + S + GDAAGR ANWAP +KKKDF+C D LFA N+ L F TP
Sbjct: 121 MWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATP 180
Query: 184 EQIFLNEKAPDFPNLP 199
E+ FL A F LP
Sbjct: 181 EEFFLKWPAARF-ELP 195
|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Length = 149 | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 369 | |||
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 100.0 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 99.96 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 99.96 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 99.94 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 99.85 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 99.76 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 99.72 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.71 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 99.71 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 99.7 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 99.69 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 99.69 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 99.67 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 99.66 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 99.66 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 99.66 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 99.64 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 99.63 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 99.63 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 99.62 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 99.61 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 99.59 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 99.55 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 99.51 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 99.51 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 99.5 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 99.48 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 99.46 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 99.42 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 99.4 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 99.39 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 99.39 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.38 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 99.35 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 99.32 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 99.23 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 99.18 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.09 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 99.04 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 99.04 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 99.02 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 99.02 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 99.0 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 98.99 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 98.97 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 98.95 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 98.94 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.94 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 98.89 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 98.89 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 98.87 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 98.87 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.86 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 98.83 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 98.82 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 98.81 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 98.81 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 98.81 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 98.79 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 98.66 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 98.66 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.61 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 98.49 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 98.43 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 98.43 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 98.4 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 98.3 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 98.2 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 98.16 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 98.15 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 98.15 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 98.14 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 98.08 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 98.08 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 98.08 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 98.05 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 98.02 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 97.96 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 97.95 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 97.95 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.94 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 97.93 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.89 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.88 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 97.86 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 97.86 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 97.84 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.83 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.82 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 97.81 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 97.8 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 97.77 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 97.71 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.7 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 97.64 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.61 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 97.59 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.55 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 97.55 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 97.54 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.53 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 97.51 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 97.45 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 97.43 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.42 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.39 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.39 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.37 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 97.37 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.37 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 97.36 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.35 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 97.22 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.2 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.19 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 97.15 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.15 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.15 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 97.09 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.09 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 97.05 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.02 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.99 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.97 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.93 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.91 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 96.89 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.8 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.79 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.78 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 96.78 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 96.74 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.72 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 96.71 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 96.7 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 96.67 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.66 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 96.63 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.6 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 96.6 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.58 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 96.55 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 96.55 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.54 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.52 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.51 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.5 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.45 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 96.31 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.3 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 96.3 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.3 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 96.29 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 96.26 | |
| d2axpa1 | 164 | Hypothetical protein YorR {Bacillus subtilis [TaxI | 96.25 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.24 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.21 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 96.2 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.18 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.17 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 96.17 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 96.1 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 96.06 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.04 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 96.01 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.0 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 95.96 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.93 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.85 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.82 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.78 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 95.7 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 95.68 | |
| d2bdea1 | 458 | Cytosolic IMP-GMP specific 5'-nucleotidase {Legion | 95.63 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 95.57 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.48 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.41 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.37 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 95.35 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.34 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.33 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 95.32 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.28 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 95.18 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 95.15 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 95.14 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.12 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 95.03 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 95.0 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.0 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 94.98 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 94.9 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.87 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.86 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 94.78 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 94.78 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.74 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 94.71 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 94.66 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 94.6 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.55 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.55 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.54 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 94.49 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 94.45 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 94.45 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.41 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 94.36 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 94.35 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.32 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 94.31 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 94.29 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.22 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 94.16 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 94.15 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 94.12 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 94.11 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 94.06 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 94.05 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 93.97 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 93.93 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 93.92 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.91 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 93.85 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 93.84 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.8 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.73 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 93.72 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.71 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 93.71 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 93.7 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 93.66 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 93.64 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 93.64 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 93.62 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 93.51 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 93.5 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 93.5 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 93.49 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 93.48 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 93.44 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 93.37 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 93.37 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 93.31 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 93.3 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 93.26 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 93.24 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 93.22 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 93.2 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 93.19 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 93.18 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 93.16 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 93.1 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.04 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.03 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 93.02 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 93.0 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 93.0 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 92.98 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 92.9 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 92.89 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 92.88 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 92.87 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 92.82 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 92.82 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 92.78 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 92.78 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 92.74 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 92.73 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 92.69 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.66 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.63 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 92.58 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 92.48 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 92.48 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 92.31 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 92.3 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 92.28 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 92.27 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.26 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 92.25 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 92.25 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 92.24 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 92.23 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 92.22 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 92.21 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 92.19 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 92.15 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 92.14 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 92.12 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 92.06 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 91.79 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 91.74 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 91.65 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 91.64 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 91.64 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.63 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.62 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 91.55 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 91.49 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 91.39 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 91.35 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 91.32 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 91.31 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 91.29 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 91.26 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 91.22 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 91.18 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.07 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 91.0 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.98 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 90.68 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 90.53 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 90.32 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 90.24 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 89.86 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 89.7 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 89.7 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 89.53 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 89.47 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 89.46 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 89.26 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 89.23 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 89.02 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 88.9 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 88.74 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 88.74 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 88.61 | |
| d1kjwa2 | 199 | Guanylate kinase-like domain of Psd-95 {Rat (Rattu | 88.58 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 88.53 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 88.4 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 88.39 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 88.21 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 88.1 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 87.85 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 87.75 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 87.54 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 87.5 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 87.39 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 87.18 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 86.75 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 86.68 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 86.58 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 86.56 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 86.41 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 86.32 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 86.24 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 86.07 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 85.94 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 85.87 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 85.81 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 85.64 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 85.61 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 85.54 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 85.48 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 85.27 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 84.72 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 84.64 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 84.62 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 84.57 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 84.51 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 84.31 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 84.09 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 84.05 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 83.79 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 82.96 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 82.45 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 82.08 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 82.07 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 81.92 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 81.72 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 81.64 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 81.45 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 81.17 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 80.92 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 80.84 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.56 | |
| d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 80.1 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 80.04 |
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: phosphatase domain of polynucleotide kinase domain: 5' polynucleotide kinase-3' phosphatase, middle domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=1.6e-52 Score=372.38 Aligned_cols=193 Identities=51% Similarity=0.920 Sum_probs=183.2
Q ss_pred CcEEecCceEEEEecCCCCCCceEEEEecCCceeecCCCCCCCCCccccccccccHHHHHHHHHHCCcEEEEEecCCCcC
Q psy4598 4 SWDIVDNGKLLVFTSNDVCNSAKIASFDLDGTLITTKSGKVFPVDTHDWKLLFSNIESVLKQYLDDGYKLVIFTNQGAIG 83 (369)
Q Consensus 4 ~W~~~~~~~~~~~~~~~~~~~~k~~~fDlDgTLi~~~sg~~~~~~~~d~~~~~p~v~~~L~~L~~~G~~i~i~TNq~gi~ 83 (369)
.|+.++ ++++|..+.+.++.|+++|||||||+.+.+|..|+.++.||++++|+|+++|+.|+++||.|+|||||+||+
T Consensus 2 ~w~~~~--~~l~~~~~~~~~~~Kia~fDrDGtLik~~~~~~~~~~~~d~~~l~~~v~~~i~~L~~~gy~iiIvTNQ~gI~ 79 (195)
T d1yj5a1 2 GWESLK--KLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKLVIFTNQMGIG 79 (195)
T ss_dssp CEEEET--TEEEEECTTCCCCSCEEEECSBTTTEECSSSCSSCSSTTCCEESCTTHHHHHHHHHHHTCEEEEEEECHHHH
T ss_pred CceecC--CEEEEcCCCCCCcCcEEEEECCCceEeeCCCCcCCCChhhceeccCCHHHHHHHHHhCCcEEEEecCcchhc
Confidence 599886 689999999999999999999999999999999999999999889999999999999999999999999999
Q ss_pred CCCCCHHHHHHHHHHHHHHcCCCeEEEEecCCCCCCCCchhHHHHHHHHhcCCccccCCccEEeeCccccccccCC-CCC
Q psy4598 84 RKKMSTRDFQAKAEKIIKSLNVPVQMFVATQYDRYRKPVPGMWEYLSQEKNGDLAIDISQSFYAGDAAGRAANWAP-KKK 162 (369)
Q Consensus 84 ~~~~~~~~~~~~i~~~l~~l~i~~~~~~~~~~~~~rKP~~gm~~~~~~~~~~~~~i~~~~s~~VGD~~gr~~~~~~-~~~ 162 (369)
+|+++.+++.++++.+++.+++++.+++|++++.||||+||||+.+++++|.+..+|+++|+||||++||+..|++ +++
T Consensus 80 rg~~s~~~~~~~~~~i~~~l~~~~~i~~~~~~~~~RKP~~GM~~~~~~~~n~~~~id~~~S~~IGD~~gr~~~~~~~~~~ 159 (195)
T d1yj5a1 80 RGKLPAEVFKGKVEAVLEKLGVPFQVLVATHAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKK 159 (195)
T ss_dssp HTSSCHHHHHHHHHHHHHHHTSCCEEEEECSSSSSSTTSTHHHHHHHHTSSSSCCCCGGGCEEECSCCCBCTTSBTTBCS
T ss_pred cCCcCHHHHHHHHHHHHHHcCCCccEEEecCccccCCCccHHHHHHHHHhcccccCCcCceEEEeCccCccccccccccc
Confidence 9999999999999999999999999999999999999999999999999987778999999999999999999887 558
Q ss_pred CCCCcccHHHHHhCCCCccCchhhccCCCCCCCCCCC
Q psy4598 163 KDFACTDHLFAFNLNLAFFTPEQIFLNEKAPDFPNLP 199 (369)
Q Consensus 163 ~d~s~~D~~~A~n~Gi~f~~pe~~f~~~~~~~~~~~~ 199 (369)
||||++|++||.|+||+|++|||||+++++.++ .+|
T Consensus 160 ~D~S~sD~~fA~N~gikF~~pee~Fl~~~~~~~-~~~ 195 (195)
T d1yj5a1 160 KDFSCADRLFALNVGLPFATPEEFFLKWPAARF-ELP 195 (195)
T ss_dssp CCSCCHHHHHHHHHTCCEECHHHHTTCCCCCCB-CCC
T ss_pred cCcchhHHHHHHHCCCcccCHHHHhcCCCcccC-CCC
Confidence 999999999999999999999999999987766 444
|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|