Diaphorina citri psyllid: psy45


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MAEEQLKVDNIRRAAAPNDHPLFIDALVDIVSSHLRSKTKINPKFLNRCPHCVNPKCSQAKQWFSQLCA
cHHHHccccccEEcccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHc
************RAAAPNDHPLFIDALVDIVSSHLRSKTKINPKFLNRCPHCVNPKCSQAKQWFSQLCA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEQLKVDNIRRAAAPNDHPLFIDALVDIVSSHLRSKTKINPKFLNRCPHCVNPKCSQAKQWFSQLCA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferrochelatase, mitochondrial Catalyzes the ferrous insertion into protoporphyrin IX.confidentQ9V9S8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HCN, chain A
Confidence level:very confident
Coverage over the Query: 2-69
View the alignment between query and template
View the model in PyMOL