Diaphorina citri psyllid: psy4606


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MGYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKEGNTMVPKSKDIF
cccEEEEcccCECcccccccEEEcccccEEEEEEEEECccccEEEEcccccEEEcccccEEEccccccc
MGYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII************IF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKEGNTMVPKSKDIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Limbic system-associated membrane protein Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection.confidentQ62813

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 3-55
View the alignment between query and template
View the model in PyMOL