Diaphorina citri psyllid: psy460


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MDEDTVSTNTSADDKTEDFCDNPTQDTIAEGLLGLIKPTVDLLDEKFRATRASQLELRLQIEALTSQLDKISAEQQTAVPLDSYTRKLVDAQQKISIVGNILQTTQVAMHKKFFMGS
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*************************DTIAEGLLGLIKPTVDLLDEKFRATRASQLELRLQIEALTSQLDKISAEQQTAVPLDSYTRKLVDAQQKISIVGNILQTTQVAMHKKFFMG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEDTVSTNTSADDKTEDFCDNPTQDTIAEGLLGLIKPTVDLLDEKFRATRASxxxxxxxxxxxxxxxxxxxxxQQTAVPLDSYTRKLVDAQQKISIVGNILQTTQVAMHKKFFMGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SNAPIN protein homolog Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in pigment granule biogenesis.confidentQ9VQF9
SNARE-associated protein Snapin May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release through its ability to potentiate the interaction of synaptotagmin with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells.confidentP60192
SNARE-associated protein Snapin May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release through its ability to potentiate the interaction of synaptotagmin with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells.confidentQ9Z266

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032844 [BP]regulation of homeostatic processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000149 [MF]SNARE bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031083 [CC]BLOC-1 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0031082
GO:0016079 [BP]synaptic vesicle exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0008150, GO:0006836
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045202 [CC]synapseprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U0C, chain A
Confidence level:confident
Coverage over the Query: 27-113
View the alignment between query and template
View the model in PyMOL