Diaphorina citri psyllid: psy4618


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MSIMESDGEANASPDSMQANRSSGSMHTLSPYSDDSSQKSDSITPSDQPLKIARDKEMGKDYLLCDYNRDGDSYRHRAAKAIDTYFKSGRGSNANE
cccccccccccccccccccccccHHHHcccccccccccHHHHHccccccCEEEEcccccccEEEcccccccccccccccccccccccccccccccc
***********ASPDSMQANRSSGSMHTLSPYSDDSSQKSDSITPSDQPLKIARDKEMGKDYLLCDYNRDGDSYRHRAAKAIDTYF**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIMESDGEANASPDSMQANRSSGSMHTLSPYSDDSSQKSDSITPSDQPLKIARDKEMGKDYLLCDYNRDGDSYRHRAAKAIDTYFKSGRGSNANE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-actin-capping protein subunit beta F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.confidentP34686

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0031115 [BP]negative regulation of microtubule polymerizationprobableGO:0031110, GO:0031111, GO:0031113, GO:0033043, GO:0051129, GO:0051128, GO:0032886, GO:0050789, GO:0044699, GO:0051494, GO:0051493, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0031333, GO:0009987, GO:0050794, GO:0044763, GO:0043254, GO:0010639, GO:0044087, GO:0008150, GO:0070507, GO:0048523
GO:0051286 [CC]cell tipprobableGO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071203 [CC]WASH complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008290 [CC]F-actin capping protein complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030479 [CC]actin cortical patchprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0001669 [CC]acrosomal vesicleprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0051016 [BP]barbed-end actin filament cappingprobableGO:0033043, GO:1901879, GO:0051129, GO:0051128, GO:0008064, GO:0032970, GO:0043244, GO:0050789, GO:0044699, GO:0043242, GO:0030832, GO:0030833, GO:0030834, GO:0030835, GO:0030837, GO:0071840, GO:0051494, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0051693, GO:0065008, GO:0009987, GO:0031333, GO:1901880, GO:0044763, GO:0032956, GO:0043254, GO:0050794, GO:0010639, GO:0044087, GO:0032535, GO:0008150, GO:0048523
GO:0005869 [CC]dynactin complexprobableGO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0016020 [CC]membraneprobableGO:0005575
GO:0032153 [CC]cell division siteprobableGO:0005575, GO:0044464, GO:0005623
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0005884 [CC]actin filamentprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AA0, chain B
Confidence level:very confident
Coverage over the Query: 11-91
View the alignment between query and template
View the model in PyMOL