Diaphorina citri psyllid: psy4624


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MGNKLSACSCAPLMRKAYRYEDSPWQTSKRRDGHLLRLWAEVFHVSASGAGSVKWQQVSEDLVPVNITCIQDAPNCIFLITAYNSQVDKILDVKLVQPGTRIGQASECFVYWKDPNTNDTWGLNFTSPIDARQFRECCVSTITFYILFKFTRSLLRNKFL
ccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHEEECcccccEEEEEcccccEEEEEEEECcccCEEEEEEEEEccccEEEEEEEEcccccCECccCEEEEEEcccccccEEEECcccHHHHHHHHHccccccccEEcccccHHHHHccc
********SCAPLMRKAYRYEDSPWQTSKRRDGHLLRLWAEVFHVSASGAGSVKWQQVSEDLVPVNITCIQDAPNCIFLITAYNSQVDKILDVKLVQPGTRIGQASECFVYWKDPNTNDTWGLNFTSPIDARQFRECCVSTITFYILFKFTRSLLRNKFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNKLSACSCAPLMRKAYRYEDSPWQTSKRRDGHLLRLWAEVFHVSASGAGSVKWQQVSEDLVPVNITCIQDAPNCIFLITAYNSQVDKILDVKLVQPGTRIGQASECFVYWKDPNTNDTWGLNFTSPIDARQFRECCVSTITFYILFKFTRSLLRNKFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051491 [BP]positive regulation of filopodium assemblyprobableGO:0051130, GO:0051489, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0048518, GO:0008150, GO:0031346, GO:0031344, GO:0050794, GO:0048522
GO:0050803 [BP]regulation of synapse structure and activityprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0044763, GO:0008150, GO:0065007, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0065008, GO:0044699, GO:0003008
GO:0050770 [BP]regulation of axonogenesisprobableGO:0022604, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JP2, chain A
Confidence level:confident
Coverage over the Query: 32-137
View the alignment between query and template
View the model in PyMOL