Diaphorina citri psyllid: psy4654

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56

MRDLLRYSPNEGALRYHESMGDNSSLAKWSSMELLNEEDESPSPSVASRQGDVIQRPPVQQVYNLFHPTDPIAVRLEPLISARFSLLAPVNIPRYQQFPLGKSQSTSVAQALLIRMVTQKWWGSKRIDYALYCPEGLANFPTNALPHLFHASFWESCDVIAFILRQVNNLLTYFRAREIGKAPRKVTQKWWGSKRIDYALYCPEGLANFPTNALPHLFHASFWESCDVIAFILRQIGRFDMAPAMGTDDKDLEGFNPGQPREKWIRKRTSVKIKNATANHRANDVIVKEGLPQTLVARFMYGPFDMFTLTVDVHLIKEPPSGEWVLMSTEVTDKTGRVSYTLPEDHKLSYGMYPVKMVVRGDHTSVDFYLAVVPPRTEVVVFSVDGSFTASVSVTGRDPKVRAGAVDIVRHWQELGYLIIYITGRPDMQQGRVLSWLSQHNFPHGLVSFADGLSPGFLGHKASYLKSLIQDHGVVIHAAYGSNKDVSVYTSVGLKPRSIYIVGKVSKKHQSQATVLSDGYAAHLTALQQHGGSRPAQGNARMVLAPKGYFGHNLSIRRR

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccHHcccccccEEEEcccccccccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccEEEEccccccccccEEEEEEEEEcccCEEEEEEEEEccccEEEEEEccccccccEEECcccccccccHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHcccccccccEEccccccccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHcccccccEEEEcccccccccccccccccHHHHHHHHHcccccccccccccEEEccccccccccccccc

**********EGALRYHESMGDNSS*******************************PPVQQVYNLFHPTDPIAVRLEPLISARFSLLAPVNIPRYQQFPLGKSQSTSVAQALLIRMV*********IDY***************************C***A*I*R***************KAPRKVTQKWWGSKRIDYALYCPEGLANFPTNALPHLFHASFWESCDVIAFILRQIGRFDMA*********************WIRKRTSVKIKNATANHRANDVIVKEGLPQTLVARFMYGPFDMFTLTVDVHLIKEPPSGEWVLMSTEVTDKTGRVSYTLPEDHKLSYGMYPVKMVVRGDHTSVDFYLAVVPPRTEVVVFSVDGSFTASVSVTGRDPKVRAGAVDIVRHWQELGYLIIYITGRPDMQQGRVLSWLSQHNFPHGLVSFADGLSPGFLGHKASYLKSLIQDHGVVIHAAYGSNKDVSVYTSVGLKPRSIYIVGKVSKKHQSQATVLSDGYAAHLTALQQ*******************YFG*NL*I***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Membrane-associated phosphatidylinositol transfer protein 3	Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes (in vitro) (By similarity). Binds calcium ions.	confident	Q9BZ71
Protein retinal degeneration B	May control phosphatidylinositol concentration in transport vesicles from the subrhabdomeric cisternae (SRC) to the rhabdomere. May function as a calcium transporter.	confident	P43125
Membrane-associated phosphatidylinositol transfer protein 2	Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes (in vitro). Binds calcium ions.	confident	Q6ZPQ6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008525 [MF]	phosphatidylcholine transporter activity	probable	GO:0005548, GO:0005319, GO:0022891, GO:0022892, GO:0015651, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0022857, GO:1901677, GO:0015075, GO:1901618, GO:0015101, GO:0003674, GO:0015665
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0046488 [BP]	phosphatidylinositol metabolic process	probable	GO:0044238, GO:0006644, GO:0006650, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0046486, GO:0044255, GO:0006629
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016056 [BP]	rhodopsin mediated signaling pathway	probable	GO:0071482, GO:0009314, GO:0009416, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0071478, GO:0008150, GO:0065007, GO:0071214, GO:0007186, GO:0009581, GO:0009582, GO:0009583, GO:0009584, GO:0009628, GO:0009987, GO:0007603, GO:0007602, GO:0044763, GO:0007154, GO:0050794, GO:0044700, GO:0051606, GO:0009605, GO:0050896, GO:0023052
GO:0035091 [MF]	phosphatidylinositol binding	probable	GO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0007608 [BP]	sensory perception of smell	probable	GO:0032501, GO:0044707, GO:0050877, GO:0007606, GO:0007600, GO:0008150, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OCU, chain A
Confidence level:confident
Coverage over the Query: 375-488
View the alignment between query and template
View the model in PyMOL

Template: 3M9L, chain A
Confidence level:probable
Coverage over the Query: 376-528
View the alignment between query and template
View the model in PyMOL

Template: 4ANK, chain A
Confidence level:probable
Coverage over the Query: 311-360
View the alignment between query and template
View the model in PyMOL