Psyllid ID: psy4654
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 559 | 2.2.26 [Sep-21-2011] | |||||||
| P43125 | 1259 | Protein retinal degenerat | yes | N/A | 0.846 | 0.375 | 0.625 | 0.0 | |
| Q3UHE1 | 974 | Membrane-associated phosp | no | N/A | 0.864 | 0.495 | 0.511 | 1e-141 | |
| Q9BZ71 | 974 | Membrane-associated phosp | yes | N/A | 0.864 | 0.495 | 0.513 | 1e-140 | |
| O35954 | 1243 | Membrane-associated phosp | no | N/A | 0.840 | 0.378 | 0.492 | 1e-135 | |
| O00562 | 1244 | Membrane-associated phosp | no | N/A | 0.840 | 0.377 | 0.488 | 1e-135 | |
| Q5U2N3 | 1242 | Membrane-associated phosp | no | N/A | 0.840 | 0.378 | 0.492 | 1e-135 | |
| Q9BZ72 | 1349 | Membrane-associated phosp | no | N/A | 0.656 | 0.272 | 0.602 | 1e-134 | |
| Q6ZPQ6 | 1335 | Membrane-associated phosp | yes | N/A | 0.656 | 0.274 | 0.6 | 1e-133 | |
| Q80YA3 | 547 | Phospholipase DDHD1 OS=Mu | no | N/A | 0.094 | 0.096 | 0.415 | 0.0001 | |
| Q8NEL9 | 900 | Phospholipase DDHD1 OS=Ho | no | N/A | 0.094 | 0.058 | 0.415 | 0.0001 |
| >sp|P43125|RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster GN=rdgB PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 634 bits (1635), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 323/516 (62%), Positives = 386/516 (74%), Gaps = 43/516 (8%)
Query: 53 VIQRPPVQQVYNLFHPTDPIAVRLEPLISARFSLLAPVNIPRYQQFPLGKSQSTSVAQAL 112
+ RP QVYNLFHPTDPIA RLEPL+SARFS+LAPVN+PRY ++PLG Q + +
Sbjct: 759 ALPRPNCHQVYNLFHPTDPIASRLEPLLSARFSILAPVNVPRYAKYPLGNGQPLHLLE-- 816
Query: 113 LIRMVTQKWWGSKRIDYALYCPEGLANFPTNALP--HLFHASFWESCDVIAFILRQVNNL 170
+I+ Q + N N L L AS + I+ ++ V+
Sbjct: 817 VIQSHPQHF-----------------NDGNNLLAGRRLSDASMQST---ISGLIENVS-- 854
Query: 171 LTYFRAREIGKAPRKVTQKWWGSKRIDYALYCPEGLANFPTNALPHLFHASFWESCDVIA 230
L+ A + KWWG+KR+DYALYCPEGL+NFP +ALPHLFHAS+WES DVIA
Sbjct: 855 LSTIHA---------LQNKWWGTKRLDYALYCPEGLSNFPAHALPHLFHASYWESPDVIA 905
Query: 231 FILRQIGRFDMAPAMGT-DDKDLEGFNPGQPREKWIRKRTSVKIKNATANHRANDVIVKE 289
FILRQIG+F+ P +G+ DDKD F+PGQPREKWI+KRTSVK+KN ANHRANDVIV+E
Sbjct: 906 FILRQIGKFEGIPFVGSNDDKDNASFHPGQPREKWIKKRTSVKLKNVAANHRANDVIVQE 965
Query: 290 GLPQTLVARFMYGPFDMFTL---TVDVHLIKEPPSGEWVLMSTEVTDKTGRVSYTLPEDH 346
G Q L ARFMYGP DM TL VDVH++K+PP+GEW +STEVTDK GR+SY++P+
Sbjct: 966 GREQRLNARFMYGPLDMITLHGEKVDVHIMKDPPAGEWTFLSTEVTDKNGRISYSIPDQV 1025
Query: 347 KLSYGMYPVKMVVRGDHTSVDFYLAVVPPRTEVVVFSVDGSFTASVSVTGRDPKVRAGAV 406
L YG+YPVKMVVRGDHTSVD Y+AVVPP TE VVFS+DGSFTAS+SVTGRDPKVRAGAV
Sbjct: 1026 SLGYGIYPVKMVVRGDHTSVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAV 1085
Query: 407 DIVRHWQELGYLIIYITGRPDMQQGRVLSWLSQHNFPHGLVSFADGLSPGFLGHKASYLK 466
D+ RHWQELGYL+IYITGRPDMQQ RV+SWLSQHNFPHGL+SFADGLS LGHK +YL
Sbjct: 1086 DVCRHWQELGYLLIYITGRPDMQQQRVVSWLSQHNFPHGLISFADGLSTDPLGHKTAYLN 1145
Query: 467 SLIQDHGVVIHAAYGSNKDVSVYTSVGLKPRSIYIVGKVSKKHQSQATVLSDGYAAHLTA 526
+L+Q+HG+ I AAYGS+KD+SVYT+VG++ I+IVGKV KK QS ATVLSDGYAAHL
Sbjct: 1146 NLVQNHGISITAAYGSSKDISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYAAHLAG 1205
Query: 527 LQQHGGSRPAQGNARMVLAPKGYF---GHNLSIRRR 559
LQ GGSRPA+GNARMV+ P+G F G + RRR
Sbjct: 1206 LQAVGGSRPAKGNARMVI-PRGCFNLPGQTANPRRR 1240
|
May control phosphatidylinositol concentration in transport vesicles from the subrhabdomeric cisternae (SRC) to the rhabdomere. May function as a calcium transporter. Drosophila melanogaster (taxid: 7227) |
| >sp|Q3UHE1|PITM3_MOUSE Membrane-associated phosphatidylinositol transfer protein 3 OS=Mus musculus GN=Pitpnm3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9BZ71|PITM3_HUMAN Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens GN=PITPNM3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O35954|PITM1_MOUSE Membrane-associated phosphatidylinositol transfer protein 1 OS=Mus musculus GN=Pitpnm1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O00562|PITM1_HUMAN Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens GN=PITPNM1 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q5U2N3|PITM1_RAT Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus GN=Pitpnm1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9BZ72|PITM2_HUMAN Membrane-associated phosphatidylinositol transfer protein 2 OS=Homo sapiens GN=PITPNM2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZPQ6|PITM2_MOUSE Membrane-associated phosphatidylinositol transfer protein 2 OS=Mus musculus GN=Pitpnm2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q80YA3|DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus GN=Ddhd1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8NEL9|DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens GN=DDHD1 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 559 | ||||||
| 328702399 | 1224 | PREDICTED: protein retinal degeneration | 0.844 | 0.385 | 0.640 | 0.0 | |
| 328702401 | 1213 | PREDICTED: protein retinal degeneration | 0.844 | 0.389 | 0.640 | 0.0 | |
| 383865293 | 1257 | PREDICTED: protein retinal degeneration | 0.862 | 0.383 | 0.625 | 0.0 | |
| 328780185 | 1260 | PREDICTED: protein retinal degeneration | 0.869 | 0.385 | 0.613 | 0.0 | |
| 270004084 | 1235 | hypothetical protein TcasGA2_TC003397 [T | 0.842 | 0.381 | 0.631 | 0.0 | |
| 380030279 | 1259 | PREDICTED: LOW QUALITY PROTEIN: protein | 0.869 | 0.386 | 0.611 | 0.0 | |
| 340711657 | 1253 | PREDICTED: protein retinal degeneration | 0.855 | 0.381 | 0.620 | 0.0 | |
| 350411856 | 1253 | PREDICTED: protein retinal degeneration | 0.855 | 0.381 | 0.622 | 0.0 | |
| 307210153 | 1276 | Protein retinal degeneration B [Harpegna | 0.840 | 0.368 | 0.638 | 0.0 | |
| 307187473 | 1271 | Protein retinal degeneration B [Camponot | 0.869 | 0.382 | 0.619 | 0.0 |
| >gi|328702399|ref|XP_001952655.2| PREDICTED: protein retinal degeneration B-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 679 bits (1751), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 326/509 (64%), Positives = 394/509 (77%), Gaps = 37/509 (7%)
Query: 54 IQRPPVQQVYNLFHPTDPIAVRLEPLISARFSLLAPVNIPRYQQFPLGKSQSTSVAQALL 113
IQRP +QQVYNLFHP+DPIA RLEPLISA+FS+L PVNIPRYQ++PLG Q + +A+
Sbjct: 724 IQRPALQQVYNLFHPSDPIASRLEPLISAKFSILPPVNIPRYQKYPLGTGQPYYLLEAV- 782
Query: 114 IRMVTQKWWGSKRIDYALYCPEGLANFPTNALPHLFHASFWESCDVIAFILRQVNNLLTY 173
TN P LF A IL V+ +
Sbjct: 783 ---------------------------QTN--PQLFTEHNHARRTSEASILSTVSGIADT 813
Query: 174 FRAREIGKAPRKVTQKWWGSKRIDYALYCPEGLANFPTNALPHLFHASFWESCDVIAFIL 233
+ I K +T+KWWGSKR+DYALYCP+GL+NFPTNALPH+FHAS+WES DVIAFIL
Sbjct: 814 LPIQAINK----LTKKWWGSKRLDYALYCPDGLSNFPTNALPHIFHASYWESSDVIAFIL 869
Query: 234 RQIGRFDMAPAMGTDDKDLEGFNPGQPREKWIRKRTSVKIKNATANHRANDVIVKEGLPQ 293
RQ FD ++G ++K++ F+P QPREKW RK T +KIKN+TA+HRANDVI++EGL Q
Sbjct: 870 RQFAIFDYNSSIGNEEKEMATFSPSQPREKWQRKTTFIKIKNSTASHRANDVIIREGLSQ 929
Query: 294 TLVARFMYGPFDMFTLT---VDVHLIKEPPSGEWVLMSTEVTDKTGRVSYTLPEDHKLSY 350
T+ ARF+YGPFDMF+L VD+H+I+EP +GEW ++TE +DK GRV+YT+PE+ L +
Sbjct: 930 TISARFIYGPFDMFSLAGEKVDIHIIREPGNGEWTHLTTEDSDKNGRVTYTIPENKSLGF 989
Query: 351 GMYPVKMVVRGDHTSVDFYLAVVPPRTEVVVFSVDGSFTASVSVTGRDPKVRAGAVDIVR 410
G+YPVKMVVRGDHTSVDF LA+VPP+TE VVFS+DGSF+ASVSVTGRDPKVR GAVDIVR
Sbjct: 990 GIYPVKMVVRGDHTSVDFLLAIVPPQTETVVFSIDGSFSASVSVTGRDPKVRPGAVDIVR 1049
Query: 411 HWQELGYLIIYITGRPDMQQGRVLSWLSQHNFPHGLVSFADGLSPGFLGHKASYLKSLIQ 470
HWQELGYLI+YITGRPDMQQ RVLSWLSQHNFPHGLVSFADGLS FL HK +YLKSL+Q
Sbjct: 1050 HWQELGYLIVYITGRPDMQQQRVLSWLSQHNFPHGLVSFADGLSTDFLAHKITYLKSLVQ 1109
Query: 471 DHGVVIHAAYGSNKDVSVYTSVGLKPRSIYIVGKVSKKHQSQATVLSDGYAAHLTALQQH 530
DH ++IHAAYGS+KD+SVY+++ LKP+ I+I+GKV +KH S ATVLSDGYAAHL+ALQ H
Sbjct: 1110 DHKMIIHAAYGSSKDISVYSALDLKPKQIFIIGKVGRKHHSMATVLSDGYAAHLSALQCH 1169
Query: 531 GGSRPAQGNARMVLAPKGYFGHNLSIRRR 559
GGSRPAQGNARM+L +G FGHN S+RRR
Sbjct: 1170 GGSRPAQGNARMLLTSRGRFGHNASMRRR 1198
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328702401|ref|XP_003241889.1| PREDICTED: protein retinal degeneration B-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|383865293|ref|XP_003708109.1| PREDICTED: protein retinal degeneration B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328780185|ref|XP_393355.3| PREDICTED: protein retinal degeneration B isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|270004084|gb|EFA00532.1| hypothetical protein TcasGA2_TC003397 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|380030279|ref|XP_003698778.1| PREDICTED: LOW QUALITY PROTEIN: protein retinal degeneration B-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340711657|ref|XP_003394389.1| PREDICTED: protein retinal degeneration B-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350411856|ref|XP_003489471.1| PREDICTED: protein retinal degeneration B-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307210153|gb|EFN86826.1| Protein retinal degeneration B [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307187473|gb|EFN72549.1| Protein retinal degeneration B [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 559 | ||||||
| FB|FBgn0003218 | 1259 | rdgB "retinal degeneration B" | 0.661 | 0.293 | 0.724 | 4.3e-169 | |
| UNIPROTKB|E1C4W3 | 1346 | Gga.10388 "Uncharacterized pro | 0.656 | 0.272 | 0.609 | 4.3e-147 | |
| UNIPROTKB|F1LXD6 | 1257 | Pitpnm2 "Protein Pitpnm2" [Rat | 0.688 | 0.306 | 0.581 | 6.3e-146 | |
| UNIPROTKB|F1LV72 | 1311 | Pitpnm2 "Protein Pitpnm2" [Rat | 0.656 | 0.279 | 0.605 | 8e-146 | |
| UNIPROTKB|E7EQC3 | 1070 | PITPNM2 "Membrane-associated p | 0.656 | 0.342 | 0.602 | 2.7e-145 | |
| UNIPROTKB|Q9BZ72 | 1349 | PITPNM2 "Membrane-associated p | 0.656 | 0.272 | 0.602 | 2.7e-145 | |
| UNIPROTKB|F1RFJ7 | 1321 | PITPNM2 "Uncharacterized prote | 0.658 | 0.278 | 0.606 | 4.3e-143 | |
| UNIPROTKB|F1N662 | 1318 | PITPNM2 "Uncharacterized prote | 0.656 | 0.278 | 0.605 | 1.1e-142 | |
| UNIPROTKB|E2R1A3 | 1327 | PITPNM2 "Uncharacterized prote | 0.688 | 0.290 | 0.581 | 8e-142 | |
| MGI|MGI:1336192 | 1335 | Pitpnm2 "phosphatidylinositol | 0.656 | 0.274 | 0.6 | 1.5e-140 |
| FB|FBgn0003218 rdgB "retinal degeneration B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1460 (519.0 bits), Expect = 4.3e-169, Sum P(2) = 4.3e-169
Identities = 274/378 (72%), Positives = 319/378 (84%)
Query: 189 KWWGSKRIDYALYCPEGLANFPTNALPHLFHASFWESCDVIAFILRQIGRFDMAPAMGT- 247
KWWG+KR+DYALYCPEGL+NFP +ALPHLFHAS+WES DVIAFILRQIG+F+ P +G+
Sbjct: 864 KWWGTKRLDYALYCPEGLSNFPAHALPHLFHASYWESPDVIAFILRQIGKFEGIPFVGSN 923
Query: 248 DDKDLEGFNPGQPREKWIRKRTSVKIKNATANHRANDVIVKEGLPQTLVARFMYGPFDMF 307
DDKD F+PGQPREKWI+KRTSVK+KN ANHRANDVIV+EG Q L ARFMYGP DM
Sbjct: 924 DDKDNASFHPGQPREKWIKKRTSVKLKNVAANHRANDVIVQEGREQRLNARFMYGPLDMI 983
Query: 308 TL---TVDVHLIKEPPSGEWVLMSTEVTDKTGRVSYTLPEDHKLSYGMYPVKMVVRGDHT 364
TL VDVH++K+PP+GEW +STEVTDK GR+SY++P+ L YG+YPVKMVVRGDHT
Sbjct: 984 TLHGEKVDVHIMKDPPAGEWTFLSTEVTDKNGRISYSIPDQVSLGYGIYPVKMVVRGDHT 1043
Query: 365 SVDFYLAVVPPRTEVVVFSVDGSFTASVSVTGRDPKVRAGAVDIVRHWQELGYLIIYITG 424
SVD Y+AVVPP TE VVFS+DGSFTAS+SVTGRDPKVRAGAVD+ RHWQELGYL+IYITG
Sbjct: 1044 SVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAVDVCRHWQELGYLLIYITG 1103
Query: 425 RPDMQQGRVLSWLSQHNFPHGLVSFADGLSPGFLGHKASYLKSLIQDHGVVIHAAYGSNK 484
RPDMQQ RV+SWLSQHNFPHGL+SFADGLS LGHK +YL +L+Q+HG+ I AAYGS+K
Sbjct: 1104 RPDMQQQRVVSWLSQHNFPHGLISFADGLSTDPLGHKTAYLNNLVQNHGISITAAYGSSK 1163
Query: 485 DVSVYTSVGLKPRSIYIVGKVSKKHQSQATVLSDGYAAHLTALQQHGGSRPAQGNARMVL 544
D+SVYT+VG++ I+IVGKV KK QS ATVLSDGYAAHL LQ GGSRPA+GNARMV+
Sbjct: 1164 DISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYAAHLAGLQAVGGSRPAKGNARMVI 1223
Query: 545 APKGYF---GHNLSIRRR 559
P+G F G + RRR
Sbjct: 1224 -PRGCFNLPGQTANPRRR 1240
|
|
| UNIPROTKB|E1C4W3 Gga.10388 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LXD6 Pitpnm2 "Protein Pitpnm2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LV72 Pitpnm2 "Protein Pitpnm2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EQC3 PITPNM2 "Membrane-associated phosphatidylinositol transfer protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BZ72 PITPNM2 "Membrane-associated phosphatidylinositol transfer protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RFJ7 PITPNM2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N662 PITPNM2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R1A3 PITPNM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1336192 Pitpnm2 "phosphatidylinositol transfer protein, membrane-associated 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9BZ71 | PITM3_HUMAN | No assigned EC number | 0.5130 | 0.8640 | 0.4958 | yes | N/A |
| P43125 | RDGB_DROME | No assigned EC number | 0.6259 | 0.8461 | 0.3756 | yes | N/A |
| Q6ZPQ6 | PITM2_MOUSE | No assigned EC number | 0.6 | 0.6565 | 0.2749 | yes | N/A |
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 559 | |||
| pfam08235 | 156 | pfam08235, LNS2, LNS2 (Lipin/Ned1/Smp2) | 2e-44 | |
| smart00775 | 157 | smart00775, LNS2, This domain is found in Saccharo | 4e-44 | |
| pfam02862 | 219 | pfam02862, DDHD, DDHD domain | 2e-33 | |
| COG5083 | 580 | COG5083, SMP2, Uncharacterized protein involved in | 6e-08 |
| >gnl|CDD|149348 pfam08235, LNS2, LNS2 (Lipin/Ned1/Smp2) | Back alignment and domain information |
|---|
Score = 154 bits (390), Expect = 2e-44
Identities = 62/157 (39%), Positives = 82/157 (52%), Gaps = 26/157 (16%)
Query: 380 VVFS-VDGSFTAS------VSVTGRDPKVRAGAVDIVRHWQELGYLIIYITGRPDMQQGR 432
VV S +DG+ TAS +S+ G+D V AG VD+VR QE GYLIIY+T RPD Q R
Sbjct: 1 VVISDIDGTITASDALGHILSIMGKD-WVHAGVVDLVRKIQENGYLIIYLTARPDGQADR 59
Query: 433 VLSWLSQH-----NFPHGLVSFA-DGLSPGF---------LGHKASYLKSLIQD--HGVV 475
++LSQH N PHG V + D L L K + L+ + Q +
Sbjct: 60 TRAYLSQHKQDGYNLPHGPVILSPDRLFAALHREVILKKPLVFKIACLRDIRQLFPNRNP 119
Query: 476 IHAAYGS-NKDVSVYTSVGLKPRSIYIVGKVSKKHQS 511
+A +G+ KDV VY SVG+ P I+ V + HQ
Sbjct: 120 FYAGFGNRIKDVIVYRSVGVPPSRIFTVNPKGEVHQE 156
|
This domain is found in Saccharomyces cerevisiae protein SMP2, proteins with an N-terminal lipin domain (Pfam: PF04571) and phosphatidylinositol transfer proteins. SMP2 (also known as PAH1) is involved in plasmid maintenance and respiration, and has been identified as a Mg2+-dependent phosphatidate phosphatase (EC:3.1.3.4) that contains a haloacid dehalogenase (HAD)-like domain. Lipin proteins are involved in adipose tissue development and insulin resistance. Length = 156 |
| >gnl|CDD|197870 smart00775, LNS2, This domain is found in Saccharomyces cerevisiae protein SMP2, proteins with an N-terminal lipin domain and phosphatidylinositol transfer proteins | Back alignment and domain information |
|---|
| >gnl|CDD|217255 pfam02862, DDHD, DDHD domain | Back alignment and domain information |
|---|
| >gnl|CDD|227415 COG5083, SMP2, Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 559 | |||
| COG5083 | 580 | SMP2 Uncharacterized protein involved in plasmid m | 100.0 | |
| KOG2116|consensus | 738 | 100.0 | ||
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 100.0 | |
| PF02862 | 227 | DDHD: DDHD domain; InterPro: IPR004177 The DDHD do | 100.0 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 99.95 | |
| KOG2308|consensus | 741 | 99.93 | ||
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 99.4 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 99.28 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 99.2 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 99.17 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.13 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 98.99 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 98.9 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 98.87 | |
| COG5663 | 194 | Uncharacterized conserved protein [Function unknow | 98.86 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 98.66 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 98.6 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 98.49 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 98.46 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 98.33 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 98.26 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 98.15 | |
| PLN02954 | 224 | phosphoserine phosphatase | 98.11 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 98.07 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 98.06 | |
| COG4850 | 373 | Uncharacterized conserved protein [Function unknow | 98.01 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 97.96 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 97.96 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 97.96 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 97.95 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 97.92 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.92 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 97.9 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 97.88 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 97.88 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 97.81 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 97.78 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 97.78 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 97.78 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 97.76 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 97.76 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 97.74 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 97.72 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 97.72 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 97.72 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 97.72 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.71 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 97.7 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 97.7 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 97.68 | |
| PRK08238 | 479 | hypothetical protein; Validated | 97.65 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 97.65 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 97.63 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 97.63 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 97.62 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 97.62 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 97.61 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 97.61 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 97.6 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 97.59 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 97.58 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.57 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 97.56 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 97.53 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 97.52 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 97.51 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 97.49 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 97.48 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.48 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 97.47 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 97.46 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 97.45 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 97.44 | |
| PRK06769 | 173 | hypothetical protein; Validated | 97.42 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 97.42 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 97.41 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 97.41 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 97.4 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 97.39 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 97.39 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 97.38 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 97.37 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 97.36 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 97.35 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 97.35 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 97.34 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 97.34 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 97.33 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 97.33 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 97.3 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 97.29 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.28 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.27 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 97.27 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 97.27 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 97.21 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.2 | |
| PLN02940 | 382 | riboflavin kinase | 97.17 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 97.16 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 97.15 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 97.13 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 97.11 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 97.08 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 97.04 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 96.98 | |
| PLN02887 | 580 | hydrolase family protein | 96.94 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 96.92 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 96.92 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 96.81 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 96.78 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 96.77 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 96.76 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 96.72 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 96.68 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 96.64 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 96.63 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 96.58 | |
| PF09949 | 100 | DUF2183: Uncharacterized conserved protein (DUF218 | 96.57 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 96.56 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 96.54 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 96.54 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 96.51 | |
| PLN02423 | 245 | phosphomannomutase | 96.47 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 96.4 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 96.39 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 96.36 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 96.31 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 96.27 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 96.23 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 96.22 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 96.07 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 96.07 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.05 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 95.63 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 95.57 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 95.19 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 95.13 | |
| cd05469 | 113 | Transthyretin_like Transthyretin_like. This domain | 95.06 | |
| PF00576 | 112 | Transthyretin: HIUase/Transthyretin family; InterP | 94.96 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 94.65 | |
| TIGR02962 | 112 | hdxy_isourate hydroxyisourate hydrolase. Members o | 94.56 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 94.55 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 94.54 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 94.44 | |
| smart00095 | 121 | TR_THY Transthyretin. | 94.3 | |
| cd05822 | 112 | TLP_HIUase HIUase (5-hydroxyisourate hydrolase) ca | 94.23 | |
| cd05821 | 121 | TLP_Transthyretin Transthyretin (TTR) is a 55 kDa | 94.16 | |
| PLN03017 | 366 | trehalose-phosphatase | 94.15 | |
| COG2351 | 124 | Transthyretin-like protein [General function predi | 93.98 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 93.9 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 93.31 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 93.07 | |
| KOG2914|consensus | 222 | 93.06 | ||
| KOG1615|consensus | 227 | 92.9 | ||
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 92.81 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 92.73 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 92.64 | |
| PRK15036 | 137 | hydroxyisourate hydrolase; Provisional | 92.56 | |
| PLN02151 | 354 | trehalose-phosphatase | 92.54 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 92.39 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 92.35 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 92.27 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 92.26 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 91.81 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 91.5 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 91.3 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 91.3 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 90.8 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 89.8 | |
| PLN02580 | 384 | trehalose-phosphatase | 89.69 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 88.34 | |
| KOG2882|consensus | 306 | 87.59 | ||
| KOG3006|consensus | 132 | 86.82 | ||
| KOG0207|consensus | 951 | 86.69 | ||
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 86.28 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 85.87 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 85.63 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 85.34 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 84.76 | |
| PF10307 | 197 | DUF2410: Hypothetical protein (DUF2410); InterPro: | 84.48 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 84.4 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 83.98 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 83.9 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 83.12 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 82.78 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 81.94 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 81.59 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 80.68 |
| >COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.1e-42 Score=358.32 Aligned_cols=256 Identities=23% Similarity=0.368 Sum_probs=228.6
Q ss_pred eeccCCCcccceeEEecCCceeEEEeeecCCCcceeee--EeEEEEec-CCCCcEEEEEEEEeCCCccEEEecC--CCCc
Q psy4654 273 IKNATANHRANDVIVKEGLPQTLVARFMYGPFDMFTLT--VDVHLIKE-PPSGEWVLMSTEVTDKTGRVSYTLP--EDHK 347 (559)
Q Consensus 273 ~~~~~~~Hr~~d~i~~~~~~~~~~~~F~yg~~d~~~l~--vdi~~~~~-~~~g~w~~~~t~~t~s~gri~~~~p--~~~~ 347 (559)
+..+.+.|...|.|+.-..+|.+.|+|.|++....... +.|+...- .+++.|...|..++|-+|.|.++.+ ..++
T Consensus 266 ~t~l~p~~~~s~evy~~~pp~~~~~~fl~s~~r~s~a~d~~sile~~hs~s~~s~~~~g~~~~d~~~tiklnsdqLr~Ln 345 (580)
T COG5083 266 VTKLHPHHNGSDEVYGKNPPQSISGDFLYSDVRVSLANDEVSILEYSHSSSEPSWNKIGEAVTDYNGTIKLNSDQLRNLN 345 (580)
T ss_pred hhccCCCcCCcceeEeeCCccccccccccCCcchhhhHHHHHHHHhhhhcccccccccceeeecccceEEcCChHHhccc
Confidence 34677888899999999999999999999999886664 77777663 5677799999999999999999999 8899
Q ss_pred CCCCccceEEEEcCCceeEEEEEEeeCCCCeeEEEeeccceecccc------ccCCCcccchhHHHHHHHHHHCCCeEEE
Q psy4654 348 LSYGMYPVKMVVRGDHTSVDFYLAVVPPRTEVVVFSVDGSFTASVS------VTGRDPKVRAGAVDIVRHWQELGYLIIY 421 (559)
Q Consensus 348 L~~G~y~vkmvV~gd~t~~~~~i~v~~~~~k~VIfDIDGTlt~sd~------~~g~D~~~~~GA~elv~~l~~~GY~IIY 421 (559)
|++|.|.++|.|+|+.++|+++|+||.++.|+||||||||||+||. .+|+|| +|.|||.++..+..|||+|.|
T Consensus 346 LkyGkn~lkf~V~g~~a~~t~~ifvwr~n~kiVVsDiDGTITkSD~~Ghv~~miGkdw-th~gVAkLYtdI~rNGYkI~Y 424 (580)
T COG5083 346 LKYGKNLLKFYVEGGKAIATMYIFVWRNNKKIVVSDIDGTITKSDALGHVKQMIGKDW-THNGVAKLYTDIDRNGYKIKY 424 (580)
T ss_pred CccCcceEEEEEcCCccEEEEEEEEEeCCCcEEEEecCCcEEehhhHHHHHHHhccch-hhcchhhhhhhhccCceEEEE
Confidence 9999999999999999999999999999999999999999999996 499997 899999999999999999999
Q ss_pred EecCCchhhHHHHHHHh---h--CCCCCceeEecC----------CCCCChhhHHHHHHHHHhhc--cCCcEEEEeCC-c
Q psy4654 422 ITGRPDMQQGRVLSWLS---Q--HNFPHGLVSFAD----------GLSPGFLGHKASYLKSLIQD--HGVVIHAAYGS-N 483 (559)
Q Consensus 422 LTaRp~~~~~~T~~WL~---q--hglP~G~L~lr~----------g~~~dp~~~K~~~L~~L~~~--~~~~i~aafGN-~ 483 (559)
+|+|+.+|+..|+.+|+ | ..+|.||++|.. .+-++||.||++||++|... ...||+||||| .
T Consensus 425 ltsR~~Gqa~sTrsylrnieQngykLpdgpviLspd~t~aal~relIlrkpE~FKiayLndl~slf~e~~PFyAGFGNri 504 (580)
T COG5083 425 LTSRSYGQADSTRSYLRNIEQNGYKLPDGPVILSPDRTMAALYRELILRKPEVFKIAYLNDLKSLFIEFDPFYAGFGNRI 504 (580)
T ss_pred EecccccchhhhhhHHHhhhhcCccCCCCCEeeccchhhhhhhhhhhhcChHHHHHHHHHHHHHhhCcCChhhccccccc
Confidence 99999999999999996 3 469999999853 36789999999999999642 22489999999 8
Q ss_pred cchhHHHhcCCCCCcEEEEcCCCcccccccee-cchhHHHHHHHHhhc
Q psy4654 484 KDVSVYTSVGLKPRSIYIVGKVSKKHQSQATV-LSDGYAAHLTALQQH 530 (559)
Q Consensus 484 ~DV~aYr~vGI~~~~If~i~~~~~~~~~~~~~-~~~~Y~~hL~~l~~~ 530 (559)
+||.+|+.+|||++||||||..|+.+.+..+. ..++| -|+.++++|
T Consensus 505 TDvisY~~vgIp~SrIFTIn~~gev~~ell~~sy~~sy-~~mne~VDh 551 (580)
T COG5083 505 TDVISYSNVGIPKSRIFTINKNGEVHGELLIVSYRSSY-KQMNELVDH 551 (580)
T ss_pred hhheeeccccCChhheEEeccCCcEEEEEEEeehhhHH-HHHhhhhhh
Confidence 99999999999999999999999887665555 45566 599999987
|
|
| >KOG2116|consensus | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >PF02862 DDHD: DDHD domain; InterPro: IPR004177 The DDHD domain is 180 residues long and contains four conserved residues that may form a metal binding site | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >KOG2308|consensus | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >COG5663 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >COG4850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF09949 DUF2183: Uncharacterized conserved protein (DUF2183); InterPro: IPR019236 This domain, found in various bacterial and fungal proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >cd05469 Transthyretin_like Transthyretin_like | Back alignment and domain information |
|---|
| >PF00576 Transthyretin: HIUase/Transthyretin family; InterPro: IPR023416 This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02962 hdxy_isourate hydroxyisourate hydrolase | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >smart00095 TR_THY Transthyretin | Back alignment and domain information |
|---|
| >cd05822 TLP_HIUase HIUase (5-hydroxyisourate hydrolase) catalyzes the second step in a three-step ureide pathway in which 5-hydroxyisourate (HIU), a product of the uricase (urate oxidase) reaction, is hydrolyzed to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU) | Back alignment and domain information |
|---|
| >cd05821 TLP_Transthyretin Transthyretin (TTR) is a 55 kDa protein responsible for the transport of thyroid hormones and retinol in vertebrates | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG2351 Transthyretin-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2914|consensus | Back alignment and domain information |
|---|
| >KOG1615|consensus | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >PRK15036 hydroxyisourate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG2882|consensus | Back alignment and domain information |
|---|
| >KOG3006|consensus | Back alignment and domain information |
|---|
| >KOG0207|consensus | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PF10307 DUF2410: Hypothetical protein (DUF2410); InterPro: IPR018812 This entry represents a family of proteins conserved in fungi whose function is not known | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 559 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 49.1 bits (116), Expect = 4e-06
Identities = 81/616 (13%), Positives = 164/616 (26%), Gaps = 237/616 (38%)
Query: 3 DLLRYSPNEGALRY-HESMGDNSSLAKWSSMELLNEEDESPSPSVASRQGDVIQRPPVQQ 61
L E ++ E + N K+ M + E PS + R ++Q
Sbjct: 69 WTLLSKQEEMVQKFVEEVLRINY---KFL-MSPIKTEQRQPSM---------MTRMYIEQ 115
Query: 62 VYNLFHPTDPIAVRLEPLISARFSLLAPVNIPRYQQFPLGKSQSTSVAQALL-IR----- 115
L+ D + A N+ R Q + + QALL +R
Sbjct: 116 RDRLY--NDN-------------QVFAKYNVSRLQPY-------LKLRQALLELRPAKNV 153
Query: 116 ----MV-TQKWW--GSKRIDYALYCPEGLANFPTNALPHLFHASFWES---CDVIAFILR 165
++ + K W + Y + C FW + C+ +L
Sbjct: 154 LIDGVLGSGKTWVALDVCLSYKVQC-----KMDFKI--------FWLNLKNCNSPETVLE 200
Query: 166 QVNNLLTYFRAREIGKAPRKVTQKWWGSKRIDYALYCPEGLANFPTNALPHLFHASFWES 225
+ LL ++ W + R D++ + + L L + +E+
Sbjct: 201 MLQKLL------------YQIDPNW--TSRSDHSSNIKLRI-HSIQAELRRLLKSKPYEN 245
Query: 226 C-----DV-----I-AF-----IL---RQIGRFDMAPAMGTDDKDLE----GFNPGQPRE 262
C +V AF IL R D A T L+ P + +
Sbjct: 246 CLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKS 305
Query: 263 ---KWIRKRTSVKIKNATANHRANDVIVKEGLPQTLVARFMYGPFDMFTLTVDVHLIKEP 319
K++ + R D LP+ ++ P L++ I++
Sbjct: 306 LLLKYL-------------DCRPQD------LPREVLTT---NP---RRLSIIAESIRDG 340
Query: 320 PS--GEWVLMSTEVTDKTGRVSYTL--PEDHKLSYGMYPVKMVVRGDHTSVDFYLAVVPP 375
+ W ++ + S + P +++ + L+V PP
Sbjct: 341 LATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMF-----------------DRLSVFPP 383
Query: 376 RTEVVVFSVDGSFTASVSVTGRDPKVRAGAVDIVRHWQELGYLIIYITGRPDMQQGRVLS 435
S + + + W ++ I + + S
Sbjct: 384 ---------------SAHIP---TIL------LSLIWFDV----IKSDVMVVVNKLHKYS 415
Query: 436 WLSQHNFP-----HGLVSFADGLSPGFLGHKASYLKSLIQ-DHGVVIHAAYGSNKDVSVY 489
+ + + YL+ ++ ++ +H V Y
Sbjct: 416 LVEKQPKESTISIPSI-----------------YLELKVKLENEYALH-----RSIVDHY 453
Query: 490 TSVGLKPRSIYIVGKVSKKHQSQATVLSDGY-----AAHLTALQQHGGSRPAQGNARMVL 544
+ + + D Y HL ++ RM L
Sbjct: 454 -----NIPKTFDSDDLIPPYL-------DQYFYSHIGHHLKNIEHPE---------RMTL 492
Query: 545 APKGYFGHNLS-IRRR 559
+ + + ++
Sbjct: 493 FRMVFL--DFRFLEQK 506
|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 559 | |||
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 99.23 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 99.19 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 98.89 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 98.88 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 98.66 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 98.65 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.6 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.55 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.5 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 98.44 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.43 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 98.4 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 98.39 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 98.34 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.33 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 98.3 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 98.29 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 98.26 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 98.25 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 98.22 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 98.21 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 98.19 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 98.19 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 98.17 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.16 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 98.15 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 98.15 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 98.14 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 98.11 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.11 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 98.11 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 98.09 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 98.07 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 98.05 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 98.05 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 98.05 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 98.04 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 98.03 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 98.03 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 98.01 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 98.01 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 97.98 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 97.97 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 97.97 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 97.96 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.96 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 97.95 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 97.94 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 97.94 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 97.94 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.92 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 97.92 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 97.91 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 97.9 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 97.89 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 97.85 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 97.83 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 97.82 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 97.82 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 97.82 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 97.81 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 97.81 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 97.8 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 97.78 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 97.78 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 97.77 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 97.75 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 97.75 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 97.74 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 97.73 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 97.73 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 97.69 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 97.68 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 97.67 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 97.67 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 97.67 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 97.67 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 97.67 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 97.66 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 97.65 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 97.65 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.65 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 97.64 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 97.63 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 97.63 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 97.63 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 97.62 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 97.6 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 97.59 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 97.59 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 97.58 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 97.58 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 97.58 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 97.57 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.57 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 97.56 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 97.55 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 97.55 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 97.55 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 97.54 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 97.53 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 97.51 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 97.5 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 97.49 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 97.49 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 97.49 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 97.48 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 97.48 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 97.47 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 97.46 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 97.46 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 97.45 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 97.41 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 97.4 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 97.38 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 97.37 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 97.36 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 97.32 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 97.32 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 97.31 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 97.3 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.3 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 97.29 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 97.25 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 97.22 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 97.21 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 97.19 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 97.15 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 97.09 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 96.98 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 96.97 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 96.97 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 96.95 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 96.94 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 96.92 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 96.89 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 96.87 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 96.8 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 96.73 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 96.62 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 96.34 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 96.14 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 96.08 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 95.76 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 95.12 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 94.35 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 94.14 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 93.91 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 93.84 | |
| 1f86_A | 115 | Transthyretin Thr119Met variant; protein stability | 93.84 | |
| 4ank_A | 147 | Transthyretin; hormone binding protein, thyroxine | 93.68 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 93.58 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 93.55 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 93.32 | |
| 2h4e_A | 127 | Transthyretin; amyloid, sulfite, familial amyloido | 93.25 | |
| 1oo2_A | 119 | Transthyretin; retinol-binding protein, tetramer, | 92.87 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 90.89 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 90.65 | |
| 2g2n_A | 114 | Transthyretin-like protein; transthyretin-related | 89.88 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 88.24 | |
| 3iwv_A | 138 | 5-hydroxyisourate hydrolase; transthyretin, molecu | 86.74 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 85.59 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 84.6 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 83.94 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 83.85 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 82.77 | |
| 3e3m_A | 355 | Transcriptional regulator, LACI family; structural | 82.63 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 82.53 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 82.52 | |
| 2h0e_A | 121 | Transthyretin-like protein PUCM; beta sandwitch, h | 81.17 |
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
Probab=99.23 E-value=1.2e-11 Score=124.72 Aligned_cols=107 Identities=15% Similarity=0.197 Sum_probs=89.6
Q ss_pred CCCeeEEEeeccceecccc---------------------ccCCCcccchhHHHHHHHHHHCCCeEEEEecCCch-hhHH
Q psy4654 375 PRTEVVVFSVDGSFTASVS---------------------VTGRDPKVRAGAVDIVRHWQELGYLIIYITGRPDM-QQGR 432 (559)
Q Consensus 375 ~~~k~VIfDIDGTlt~sd~---------------------~~g~D~~~~~GA~elv~~l~~~GY~IIYLTaRp~~-~~~~ 432 (559)
.++++|||||||||+++.. ..+.+ ++.+|+.++++.++++|++|+|||+|+.. +++.
T Consensus 56 ~~~~avVfDIDgTlldn~~y~~~~~~~~~~f~~~~w~~wv~~~~~-~~~pG~~ell~~L~~~G~ki~ivTgR~~~~~r~~ 134 (262)
T 3ocu_A 56 GKKKAVVADLNETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQS-RAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSG 134 (262)
T ss_dssp TCEEEEEECCBTTTEECHHHHHHHHHHTCCCCHHHHHHHHHHTCC-EECTTHHHHHHHHHHTTEEEEEEEEEETTTTHHH
T ss_pred CCCeEEEEECCCcCCCCchhhhhhccccccCCHHHHHHHHHcCCC-CCCccHHHHHHHHHHCCCeEEEEeCCCccchHHH
Confidence 4678999999999999862 13444 47899999999999999999999999998 9999
Q ss_pred HHHHHhhCCCCC-c--eeEecCCCCCChhhHHHHHHHHHhhccCCcEEEEeCC-ccchhH
Q psy4654 433 VLSWLSQHNFPH-G--LVSFADGLSPGFLGHKASYLKSLIQDHGVVIHAAYGS-NKDVSV 488 (559)
Q Consensus 433 T~~WL~qhglP~-G--~L~lr~g~~~dp~~~K~~~L~~L~~~~~~~i~aafGN-~~DV~a 488 (559)
|+.||.++|||. + .|+|+++. .+|...++.|.. .|..|++-+|| ..|+..
T Consensus 135 T~~~L~~lGi~~~~~~~Lilr~~~-----~~K~~~r~~l~~-~Gy~iv~~vGD~~~Dl~~ 188 (262)
T 3ocu_A 135 TIDDMKRLGFNGVEESAFYLKKDK-----SAKAARFAEIEK-QGYEIVLYVGDNLDDFGN 188 (262)
T ss_dssp HHHHHHHHTCSCCSGGGEEEESSC-----SCCHHHHHHHHH-TTEEEEEEEESSGGGGCS
T ss_pred HHHHHHHcCcCcccccceeccCCC-----CChHHHHHHHHh-cCCCEEEEECCChHHhcc
Confidence 999999999996 5 78888642 257777888753 36889999999 588875
|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1f86_A Transthyretin Thr119Met variant; protein stability, X-RAY amyloidogenesis, transport protein; HET: T44; 1.10A {Homo sapiens} SCOP: b.3.4.1 PDB: 1fhn_A 1bze_A 1fh2_A 1bzd_A 3fcb_A* 3fc8_A* 3cfm_A 3cfn_A* 3cfq_A* 3cft_A* 3m1o_A* 1bmz_A 1bm7_A 1e3f_A* 1e5a_A* 1e4h_A 1ict_A* 1tt6_A* 1tta_A 1tyr_A* ... | Back alignment and structure |
|---|
| >4ank_A Transthyretin; hormone binding protein, thyroxine transport protein, hormon amyloidosis inhibition; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2h4e_A Transthyretin; amyloid, sulfite, familial amyloidotic polyne transport protein; HET: CSU; 1.45A {Homo sapiens} SCOP: b.3.4.1 PDB: 2wqa_A* 1zcr_A 1zd6_A 2trh_A 1bz8_A 2qpf_A 1tfp_A | Back alignment and structure |
|---|
| >1oo2_A Transthyretin; retinol-binding protein, tetramer, transport protein; 1.56A {Sparus aurata} SCOP: b.3.4.1 PDB: 1sn2_A 1sn0_A 1sn5_A* | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >2g2n_A Transthyretin-like protein; transthyretin-related protein, unknown functi; 1.65A {Escherichia coli} PDB: 2g2p_A 2igl_A 2gpz_A | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >3iwv_A 5-hydroxyisourate hydrolase; transthyretin, molecular evolution, URIC acid degradation, T hormones, peroxisome, purine metabolism; 1.68A {Danio rerio} PDB: 3iwu_A 3q1e_A 2h6u_A 2h1x_A | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2h0e_A Transthyretin-like protein PUCM; beta sandwitch, hydrolase, HIU; 2.20A {Bacillus subtilis} PDB: 2h0f_A* 2h0j_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 559 | ||||
| d1ltqa1 | 149 | c.108.1.9 (A:153-301) Polynucleotide kinase, phosp | 7e-09 | |
| d2obba1 | 122 | c.108.1.25 (A:1-122) Hypothetical protein BT0820 { | 0.001 |
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Length = 149 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: phosphatase domain of polynucleotide kinase domain: Polynucleotide kinase, phosphatase domain species: Bacteriophage T4 [TaxId: 10665]
Score = 52.8 bits (126), Expect = 7e-09
Identities = 20/137 (14%), Positives = 41/137 (29%), Gaps = 15/137 (10%)
Query: 374 PPRTEVVVFSVDGSFTASVSVTGRDP------KVRAGAVDIVRHWQELGYLIIYITGRPD 427
P + + V+F VDG+ D + V++ + + +GY I+ ++GR
Sbjct: 4 PGKPKAVIFDVDGTLAKMNGRGPYDLEKCDTDVINPMVVELSKMYALMGYQIVVVSGRES 63
Query: 428 MQQGRVLSWLSQHNFP--HGLVSFADGLSPGFLGHKAS-------YLKSLIQDHGVVIHA 478
+ + G I H V A
Sbjct: 64 GTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLA 123
Query: 479 AYGSNKDVSVYTSVGLK 495
+ V ++ +G++
Sbjct: 124 IDDRTQVVEMWRRIGVE 140
|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 122 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 559 | |||
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.76 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 99.42 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 99.27 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 98.69 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 98.69 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 98.54 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 98.35 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.23 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.05 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 97.98 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 97.98 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 97.9 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 97.89 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 97.88 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 97.87 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.86 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 97.85 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 97.81 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 97.8 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 97.8 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 97.8 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 97.79 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 97.79 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 97.73 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 97.72 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 97.71 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 97.71 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.7 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 97.69 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 97.66 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 97.59 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 97.58 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 97.53 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 97.49 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 97.45 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 97.4 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 97.36 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 97.28 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 97.16 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 97.11 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 97.1 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 97.02 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 96.93 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 96.9 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 96.88 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 96.56 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 96.51 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 96.34 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 96.33 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 96.31 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 96.18 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 96.18 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 95.96 | |
| d1f86a_ | 115 | Transthyretin (synonym: prealbumin) {Human (Homo s | 95.54 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 94.07 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 93.98 | |
| d1oo2a_ | 116 | Transthyretin (synonym: prealbumin) {Gilthead seab | 93.54 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 88.82 |
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: phosphatase domain of polynucleotide kinase domain: Polynucleotide kinase, phosphatase domain species: Bacteriophage T4 [TaxId: 10665]
Probab=99.76 E-value=9.3e-19 Score=155.25 Aligned_cols=123 Identities=15% Similarity=0.237 Sum_probs=100.3
Q ss_pred CCCCeeEEEeeccceeccccc-------cCCCcccchhHHHHHHHHHHCCCeEEEEecCCchhhHHHHHHHhh-------
Q psy4654 374 PPRTEVVVFSVDGSFTASVSV-------TGRDPKVRAGAVDIVRHWQELGYLIIYITGRPDMQQGRVLSWLSQ------- 439 (559)
Q Consensus 374 ~~~~k~VIfDIDGTlt~sd~~-------~g~D~~~~~GA~elv~~l~~~GY~IIYLTaRp~~~~~~T~~WL~q------- 439 (559)
|..+|+|||||||||+++... +..+ .+.+||+++++.++++||+|+|+|+|++.+++.|.+||.+
T Consensus 4 ~~kpk~vifDiDgTL~~~~~~~~~~~~~~~~~-~~~p~v~~~l~~l~~~G~~Iii~T~R~~~~~~~t~~~l~~~~~~~~~ 82 (149)
T d1ltqa1 4 PGKPKAVIFDVDGTLAKMNGRGPYDLEKCDTD-VINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVED 82 (149)
T ss_dssp TTSCEEEEEETBTTTBCCSSCCTTCGGGGGGC-CBCHHHHHHHHHHHHTTCEEEEEECSCCCCSSSTTHHHHHHHHHHHH
T ss_pred CCCCcEEEEEcCCCcEeCCCCCcCCccccccC-ccCHHHHHHHHHHHhccCeEEEEecCcHHHHHHHHHHHHHHhhhhhh
Confidence 568899999999999998753 3344 4799999999999999999999999999999999999976
Q ss_pred -CCCCCceeEecCCC-CCChhhHHHHHHHHHhhccCCcEEEEeCC-ccchhHHHhcCCCCCc
Q psy4654 440 -HNFPHGLVSFADGL-SPGFLGHKASYLKSLIQDHGVVIHAAYGS-NKDVSVYTSVGLKPRS 498 (559)
Q Consensus 440 -hglP~G~L~lr~g~-~~dp~~~K~~~L~~L~~~~~~~i~aafGN-~~DV~aYr~vGI~~~~ 498 (559)
++.+...+.++... .+.+...|...++++.. ....+...+|| ..||.+|+++||++-+
T Consensus 83 ~~~~~~~~~~~~~~~~~~~d~~~k~~~l~~~~~-~~~~i~~~igD~~~dv~a~~~~Gi~~~~ 143 (149)
T d1ltqa1 83 IAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIA-PHFDVKLAIDDRTQVVEMWRRIGVECWQ 143 (149)
T ss_dssp TTCCCCSEEEECCTTCCSCHHHHHHHHHHHHTT-TTCEEEEEEECCHHHHHHHHHTTCCEEE
T ss_pred cCCCcEEEeecccccccCCchHHHHHHHHHhcc-CCCceEEEEcCCHHHHHHHHHCCCcEEE
Confidence 46777777776532 23334688888888743 35568889999 7999999999999743
|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1f86a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oo2a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Gilthead seabream (Sparus aurata) [TaxId: 8175]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|