Diaphorina citri psyllid: psy4655

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-----
MLIKEYRIPLPLTVDEYKIAQLYMIAKKSREESKGAGSGVEILYNEPYDNDEEAPGTKGQKTVKIYPLEWKIYHVGSHLPGWIKSLLPKSALEVKYRIPLPLTVDEYKIAQLYMIAVSDLSQGGDISSQHRIKQTFNLRSSLTRLGLKPYSKKLNPRLRCGDCRGKEFQLSGSDLRSRIVEVIDVVKDQLYGGDYVREEDPSIYVSKTTGRGPLSENWISEYWNAVKEDPTVSHDNKSMMCAYKLCKIQLNYWGIQSKGHDQPHNGQALMCAYKLCRVQFHYWGMQTKLENPEENHKIYHVGSHLPGWIKSLLPKSALEVKEEAWNAYPFTKTVYSCDFVKNFKLEITTKYLPESVLAWAWQDEWNGLNIEDIRKIERDTAEALKLKMSDANVDMTAKKSDTTTFRGAFESVIRQHYPSMMGRGHDQPHNGQALMCAYKLCRVQFHYWGMQTKLEKFVHEFGKVAGKKRGLASVLAWAWQDEWNGLNIEDIRKIERDTAEALKLKMSGGANGTDIPSDGLQSASSHSTAPSASTITSAPNPALKTLADALDSIEKSDSELQQHVSTPKPASVPASASSKHLSSHSSNYSEAILNT
cEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccEEEEECcccccccccccccccccccccccEEEEEEcccccHHHHHHHcccccEEEEEcccccCCcccccccccEEEEEEccccccccccccccccccEEEcccECccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEcccccccccccHHHHHHHccccccccccccccEEEEEEEEEEEEEEEcccccccccccccEEEEEEEEEEEEEEcccccccccccccccHHHHHccccccccHHcccccccccHHHHHcccccEEEEEEcccccccEEEEEEEEEcccccccccccccccccccccHHHccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEcccHHHHHHHHHHHHHcccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccHHHHcc
MLIKEYRIPLPLTVDEYKIAQLYMIA****************LYNEPYDNDEEAPGTKGQKTVKIYPLEWKIYHVGSHLPGWIKSLLPKSALEVKYRIPLPLTVDEYKIAQLYMIAVSDLSQGGDISSQHRIKQTFNLRSSLTRLGLKPYSKKLNPRLRCGDCRGKEFQLSGSDLRSRIVEVIDVVKDQLYGGDYVREEDPSIYVSKTTGRGPLSENWISEYWNAVKEDPTVSHDNKSMMCAYKLCKIQLNYWGIQSKGHDQPHNGQALMCAYKLCRVQFHYWGMQTKLENPEENHKIYHVGSHLPGWIKSLLPKSALEVKEEAWNAYPFTKTVYSCDFVKNFKLEITTKYLPESVLAWAWQDEWNGLNIEDIRKIERDTAEALKLKMSDANVDMTAKKSDTTTFRGAFESVIRQHYPSMMGRGHDQPHNGQALMCAYKLCRVQFHYWGMQTKLEKFVHEFGKVAGKKRGLASVLAWAWQDEWNGLNIEDIRKIERD**************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIKEYRIPLPLTVDEYKIAQLYMIAKKSREESKGAGSGVEILYNEPYDNDEEAPGTKGQKTVKIYPLEWKIYHVGSHLPGWIKSLLPKSALEVKYRIPLPLTVDEYKIAQLYMIAVSDLSQGGDISSQHRIKQTFNLRSSLTRLGLKPYSKKLNPRLRCGDCRGKEFQLSGSDLRSRIVEVIDVVKDQLYGGDYVREEDPSIYVSKTTGRGPLSENWISEYWNAVKEDPTVSHDNKSMMCAYKLCKIQLNYWGIQSKGHDQPHNGQALMCAYKLCRVQFHYWGMQTKLENPEENHKIYHVGSHLPGWIKSLLPKSALEVKEEAWNAYPFTKTVYSCDFVKNFKLEITTKYLPESVLAWAWQDEWNGLNIEDIRKIERDTAEALKLKMSDANVDMTAKKSDTTTFRGAFESVIRQHYPSMMGRGHDQPHNGQALMCAYKLCRVQFHYWGMQTKLEKFVHEFGKVAGKKRGLASVLAWAWQDEWNGLNIEDIRKIERDTAEALKLKMSGGANGTDIPSDGLQSASSHSTAPSASTITSAPNPALKTLADALDSIEKSDSELQQHVSTPKPASVPASASSKHLSSHSSNYSEAILNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003674 [MF]molecular_functionprobable
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KCM, chain A
Confidence level:very confident
Coverage over the Query: 1-118,135-223,364,429-504
View the alignment between query and template
View the model in PyMOL
Template: 1KCM, chain A
Confidence level:very confident
Coverage over the Query: 292-403
View the alignment between query and template
View the model in PyMOL
Template: 1T27, chain A
Confidence level:confident
Coverage over the Query: 1-131,143-157,171-264
View the alignment between query and template
View the model in PyMOL
Template: 2A1L, chain A
Confidence level:confident
Coverage over the Query: 1-114,125-154,177-258
View the alignment between query and template
View the model in PyMOL