Diaphorina citri psyllid: psy4671

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MFVNKFTENPTTVQFDHRVLGISVFSLLTAQYWMGRKLKLPGRANLALACVTGMAYMQVALGITTLLTYVPVSIAALHQSGSLILLSMALWLSHEMKHVKRLVK
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MFVNKFTENPTTVQFDHRVLGISVFSLLTAQYWMGRKLKLPGRANLALACVTGMAYMQVALGITTLLTYVPVSIAALHQSGSLILLSMALWLSHEMKHVKR***
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVNKFTENPTTVQFDHRVLGISVFSLLTAQYWMGRKLKLPGRANLALACVTGMAYMQVALGITTLLTYVPVSIAALHQSGSLILLSMALWLSHEMKHVKRLVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase assembly protein COX15 homolog May be involved in the biosynthesis of heme A.confidentQ8BJ03
Cytochrome c oxidase assembly protein COX15 homolog May be involved in the biosynthesis of heme A.confidentQ7KZN9
Cytochrome c oxidase assembly protein COX15 homolog May be involved in the biosynthesis of heme A.confidentQ08DG6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted