Required for the assembly of yeast cytochrome oxidase. Involved in the biosynthesis of heme A and the initial step in this pathway, the hydroxylation of heme O, is thought to be catalyzed by a three-component mono-oxygenase consisting of COX15, ferredoxin and ferredoxin reductase.
Score = 122 bits (306), Expect = 3e-26, Method: Compositional matrix adjust.
Identities = 60/98 (61%), Positives = 75/98 (76%)
Query: 7 TENPTTVQFDHRVLGISVFSLLTAQYWMGRKLKLPGRANLALACVTGMAYMQVALGITTL 66
TENPTTVQF+HR+LGIS +L TA + + R+++LP RAN A+ V MA+ Q LG+TTL
Sbjct: 296 TENPTTVQFNHRILGISTVTLTTALWLVTRRMQLPKRANWAINAVVAMAWTQATLGVTTL 355
Query: 67 LTYVPVSIAALHQSGSLILLSMALWLSHEMKHVKRLVK 104
L YVPV +A HQSGSLILLS ALWLSHE++ +K L K
Sbjct: 356 LNYVPVPLATAHQSGSLILLSFALWLSHEVRLLKYLPK 393
Source: Drosophila erecta
Species: Drosophila erecta
Genus: Drosophila
Family: Drosophilidae
Order: Diptera
Class: Insecta
Phylum: Arthropoda
Superkingdom: Eukaryota
>gi|170065643|ref|XP_001868025.1| cytochrome c oxidase assembly protein COX15 [Culex quinquefasciatus] gi|167862567|gb|EDS25950.1| cytochrome c oxidase assembly protein COX15 [Culex quinquefasciatus]
This is a family of integral membrane proteins. CtaA is required for cytochrome aa3 oxidase assembly in Bacillus subtilis. COX15 is required for cytochrome c oxidase assembly in yeast. Length = 301
>gnl|CDD|224528 COG1612, CtaA, Uncharacterized protein required for cytochrome oxidase assembly [Posttranslational modification, protein turnover, chaperones]
>PF02628 COX15-CtaA: Cytochrome oxidase assembly protein; InterPro: IPR003780 This entry represents 2 activities required for heme biosynthesis: Protoheme IX farnesyltransferase converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group
Heme A synthase catalyzes the oxidation of the C8 methyl side group on heme O porphyrin ring into a formyl group. The entry contains CtaA, which is required for cytochrome aa3 biosynthesis and sporulation in Bacillus subtilis [] and in Saccharomyces cerevisiae (Baker's yeast) the COX15 protein is required for cytochrome c oxidase assembly.; GO: 0016627 oxidoreductase activity, acting on the CH-CH group of donors, 0006461 protein complex assembly, 0055114 oxidation-reduction process, 0016020 membrane
>COG1612 CtaA Uncharacterized protein required for cytochrome oxidase assembly [Posttranslational modification, protein turnover, chaperones]
>PF02628 COX15-CtaA: Cytochrome oxidase assembly protein; InterPro: IPR003780 This entry represents 2 activities required for heme biosynthesis: Protoheme IX farnesyltransferase converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group
Heme A synthase catalyzes the oxidation of the C8 methyl side group on heme O porphyrin ring into a formyl group. The entry contains CtaA, which is required for cytochrome aa3 biosynthesis and sporulation in Bacillus subtilis [] and in Saccharomyces cerevisiae (Baker's yeast) the COX15 protein is required for cytochrome c oxidase assembly.; GO: 0016627 oxidoreductase activity, acting on the CH-CH group of donors, 0006461 protein complex assembly, 0055114 oxidation-reduction process, 0016020 membrane
>COG1612 CtaA Uncharacterized protein required for cytochrome oxidase assembly [Posttranslational modification, protein turnover, chaperones]
>PF00033 Cytochrom_B_N: Cytochrome b(N-terminal)/b6/petB; InterPro: IPR016174 This entry represents a haem-binding domain with a 4-helical bundle structure that is found in transmembrane di-haem cytochromes
The domain contains four transmembrane helices in an up-and-down bundle, and binds two haem groups in between the helices; three of the four haem-binding residues is conserved between family members. Proteins containing this domain include: N-terminal domain of mitochondrial cytochrome b subunit, in which the domain contains an extra transmembrane linker helix that is absent in plant and cyanobacteria subunits []. Cytochrome b6 subunit of the cytochrome b6f complex, which provides the electronic connection between the photosystems I and II reaction centres of oxygenic photosynthesis, and generates a transmembrane electrochemical proton gradient for adenosine triphosphate synthesis []. Cytochrome gamma subunit of formate dehydrogenase-N (Fdn-N), which acts as a major component of Escherichia coli nitrate respiration []. ; GO: 0022904 respiratory electron transport chain, 0016020 membrane; PDB: 1KQG_C 1KQF_C.
Cytochrome b-561 recycles ascorbate for the generation of norepinephrine by dopamine-beta-hydroxylase in the chromaffin vesicles of the adrenal gland. It is a transmembrane heme protein with the two heme groups being bound to conserved histidine residues. A cytochrome b-561 homologue, termed Dcytb, is an iron-regulated ferric reductase in the duodenal mucosa. Other homologues of these are also likely to be ferric reductases. SDR2 is proposed to be important in regulating the metabolism of iron in the onset of neurodegenerative disorders.
>PF04238 DUF420: Protein of unknown function (DUF420); InterPro: IPR007352 This is a predicted membrane protein with four transmembrane helices
Members of this family are integral membrane proteins and contain a protoheame IX centre B558. Cytochrome bd may play an important role in microaerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae, where it is expressed under all conditions that permit diazotrophy []. Subunit I binds a single b-haem, through ligands at His186 and Met393 (using P0ABJ9 from SWISSPROT numbering). In addition His19 is a ligand for the haem b found in subunit II (IPR003317 from INTERPRO).; GO: 0016020 membrane
