Diaphorina citri psyllid: psy4687


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MSLLLNLMMLNSYNNIINGGESKNEPPPRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLIEEASAEEEELLGKSEENTEETEQVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAEKVEEVKKE
cccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEcccccccccEEEEEEEEcccccHHHHHHHHccccccccCEEEEEcccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHccHHcccCCcccccccccccHHHHHHHHHHHcHHHHHHHHcc
***LLNLMMLNSYNNII***************RTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWT********************LQNITDYLI*************************PNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHT****************YCSTFQNKMSSLVSS***********LGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAEK*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLLNLMMLNSYNNIINGGESKNEPPPRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLxxxxxxxxxxxxxxxxxxxxxTEQVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAEKVEEVKKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serrate RNA effector molecule homolog Acts as a mediator between the cap-binding complex (CBC) and the primary microRNAs (miRNAs) processing machinery during cell proliferation. Contributes to the stability and delivery of capped primary miRNA transcripts to the primary miRNA processing complex containing DGCR8 and DROSHA, thereby playing a role in RNA-mediated gene silencing (RNAi) by miRNAs. Binds capped RNAs (m7GpppG-capped RNA); however interaction is probably mediated via its interaction with NCBP1/CBP80 component of the CBC complex. Involved in cell cycle progression at S phase. Does not directly confer arsenite resistance but rather modulates arsenic sensitivity. Independently of its activity on miRNAs, necessary and sufficient to promote neural stem cell self-renewal. Does so by directly binding SOX2 promoter and positively regulating its transcription.confidentQ5R539
Serrate RNA effector molecule homolog Acts as a mediator between the cap-binding complex (CBC) and the primary microRNAs (miRNAs) processing machinery during cell proliferation. Contributes to the stability and delivery of capped primary miRNA transcripts to the primary miRNA processing complex, thereby playing a role in RNA-mediated gene silencing (RNAi) by miRNAs (By similarity). Independently of its activity on miRNAs, necessary and sufficient to promote neural stem cell self-renewal. Does so by directly binding SOX2 promoter and positively regulating its transcription.confidentQ66I22
Serrate RNA effector molecule homolog Acts as a mediator between the cap-binding complex (CBC) and RNA-mediated gene silencing (RNAi). Involved in innate immunity via the short interfering RNAs (siRNAs) processing machinery by restricting the viral RNA production. Also involved microRNA (miRNA)-mediated silencing by contributing to the stability and delivery of primary miRNA transcripts to the primary miRNA processing complex containing drosha and pasha.confidentQ9V9K7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AX1, chain A
Confidence level:very confident
Coverage over the Query: 118-162,183-239,253-338
View the alignment between query and template
View the model in PyMOL
Template: 2DO4, chain A
Confidence level:probable
Coverage over the Query: 26-108
View the alignment between query and template
View the model in PyMOL