Psyllid ID: psy4687


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MSLLLNLMMLNSYNNIINGGESKNEPPPRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLIEEASAEEEELLGKSEENTEETEQVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAEKVEEVKKE
cccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEcccccccccEEEEEEEEcccccHHHHHHHHccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHccHHcccEEcccccccccccHHHHHHHHHHHcHHHHHHHHcc
ccHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEccccccccEEEEEEEEEcccccHHHHHHHHccccccccccccEEcccHHHHEcccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccEccccccccHHHcccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHcccccEccccccccccHHHHHHHHHHHcHHHHHHHHcc
MSLLLNLMMLNSYnniinggesknepppralhrtssiflrnlaptiTKAEVENLCKRYSGFLRvaiadpqpdrrwfrrgwvtfrrDVDIKEICWNLnnirlrdcelgaivnrdlsrrvrtvsgltslkpvvqfdmklslwtdgqepaqqpmsytlssknpvlQNITDYLIEEASAEEEELlgkseenteeteqvdpNVLRVLDRLILYLRIVHSVdyynhceypnedempnrcgiihtrgsapaskvtpqEITDYCSTFQNKmsslvsspqeptpeeldqlgakKTDAEVEKFIAANTQeistdkwlcplsgkkfkgpdfirKHIFNKHAEKVEEVKKE
MSLLLNLMMLNSYNNIINGGESKNEPPPRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLrvaiadpqpdrrwfrrgwvtfrrdvdIKEICwnlnnirlrdcelgaivnrdlsrrvrtvsgltslkpvvqFDMKLSLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLIEEASAEEEEllgkseenteeteqvdpnvlRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRgsapaskvtpQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAantqeistdkwlcplsgKKFKGPDFIRKHIFNkhaekveevkke
mslllnlmmlnsynniinGGESKNEPPPRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLIeeasaeeeellgkseenteeTEQVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAekveevkke
***LLNLMMLNSYNNII*****************SSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWT********************LQNITDYLI**************************NVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHT****************YC***********************************KFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFN************
********************************RTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWT******************************************************PNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRC**********************CSTFQNKMSSLVSS***********LGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAEK*******
MSLLLNLMMLNSYNNIINGGESKNEPPPRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLIEEASA*******************DPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNK******************LGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHA*********
*SLLLNLMMLNSYNNIINGGESKNEPPPRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWTDGQE**QQPMSYTLSSKNPVLQNITDYLIEEASAEEE*LL**********EQVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAEKVEEVKK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLLNLMMLNSYNNIINGGESKNEPPPRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKLSLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLxxxxxxxxxxxxxxxxxxxxxTEQVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAEKVEEVKKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
Q17FR9937 Serrate RNA effector mole N/A N/A 0.920 0.332 0.672 1e-126
B4NYV0944 Serrate RNA effector mole N/A N/A 0.917 0.329 0.619 1e-117
Q5TUF1 967 Serrate RNA effector mole yes N/A 0.917 0.321 0.653 1e-116
B4LIK8963 Serrate RNA effector mole N/A N/A 0.932 0.328 0.597 1e-113
Q28WQ8951 Serrate RNA effector mole yes N/A 0.914 0.325 0.620 1e-113
B4H732951 Serrate RNA effector mole N/A N/A 0.914 0.325 0.618 1e-112
B3MJ69948 Serrate RNA effector mole N/A N/A 0.917 0.328 0.632 1e-112
B3N3F7947 Serrate RNA effector mole N/A N/A 0.917 0.328 0.619 1e-112
B4MR461000 Serrate RNA effector mole N/A N/A 0.932 0.316 0.609 1e-111
B4J4971011 Serrate RNA effector mole N/A N/A 0.917 0.307 0.602 1e-111
>sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 Back     alignment and function desciption
 Score =  452 bits (1162), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 260/330 (78%), Gaps = 18/330 (5%)

Query: 28  PRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDV 87
           PRALHRTSSIFLRNLAP+ITKAEVE +CKRY+GFLRVAIADP  +RRWFRRGWVTFRRDV
Sbjct: 508 PRALHRTSSIFLRNLAPSITKAEVEAMCKRYNGFLRVAIADPLLERRWFRRGWVTFRRDV 567

Query: 88  DIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKL---------- 137
           +IKEICWNLNNIRLRDCELGAIVN+DLSRRVR V+GLT  K +V+ D+KL          
Sbjct: 568 NIKEICWNLNNIRLRDCELGAIVNKDLSRRVRPVNGLTCHKTIVRSDIKLCAKIAHNLDD 627

Query: 138 --SLWTDGQEPAQQ-PMSYTLSSKNPVLQNITDYLIEEASAEEEELLGKSEE-----NTE 189
              LW + ++  ++   S+ L SKNPVLQNITDYLIEEASAEE+ELLG S E     N  
Sbjct: 628 KVGLWKEQEDNGEKNGESFGLQSKNPVLQNITDYLIEEASAEEDELLGLSTEAAKKSNDG 687

Query: 190 ETEQVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTP 249
           E  + D  ++ VLD+LILYLR+VHS+D+YNHCEYP EDEMPNRCGIIH RG  P +KVT 
Sbjct: 688 ELVERDTQLIEVLDKLILYLRVVHSIDFYNHCEYPYEDEMPNRCGIIHARGPPPQNKVTS 747

Query: 250 QEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCP 309
            EI +Y  TF+ KM S ++   +   EE+ +LGAK  +AEVEKFI ANTQE++ DKWLCP
Sbjct: 748 NEIQEYIRTFEGKMGSFLARAVDLEEEEMKKLGAKDAEAEVEKFIQANTQELAKDKWLCP 807

Query: 310 LSGKKFKGPDFIRKHIFNKHAEKVEEVKKE 339
           LSGKKFKGPDF+RKHIFNKH EKV+EV+KE
Sbjct: 808 LSGKKFKGPDFVRKHIFNKHNEKVDEVRKE 837




Acts as a mediator between the cap-binding complex (CBC) and RNA-mediated gene silencing (RNAi). Involved in innate immunity via the short interfering RNAs (siRNAs) processing machinery by restricting the viral RNA production. Also involved microRNA (miRNA)-mediated silencing by contributing to the stability and delivery of primary miRNA transcripts to the primary miRNA processing complex.
Aedes aegypti (taxid: 7159)
>sp|B4NYV0|SRRT_DROYA Serrate RNA effector molecule homolog OS=Drosophila yakuba GN=Ars2 PE=3 SV=1 Back     alignment and function description
>sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 Back     alignment and function description
>sp|B4LIK8|SRRT_DROVI Serrate RNA effector molecule homolog OS=Drosophila virilis GN=Ars2 PE=3 SV=1 Back     alignment and function description
>sp|Q28WQ8|SRRT_DROPS Serrate RNA effector molecule homolog OS=Drosophila pseudoobscura pseudoobscura GN=Ars2 PE=3 SV=2 Back     alignment and function description
>sp|B4H732|SRRT_DROPE Serrate RNA effector molecule homolog OS=Drosophila persimilis GN=Ars2 PE=3 SV=1 Back     alignment and function description
>sp|B3MJ69|SRRT_DROAN Serrate RNA effector molecule homolog OS=Drosophila ananassae GN=Ars2 PE=3 SV=1 Back     alignment and function description
>sp|B3N3F7|SRRT_DROER Serrate RNA effector molecule homolog OS=Drosophila erecta GN=Ars2 PE=3 SV=1 Back     alignment and function description
>sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 Back     alignment and function description
>sp|B4J497|SRRT_DROGR Serrate RNA effector molecule homolog OS=Drosophila grimshawi GN=Ars2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
170034245 747 arsenite-resistance protein [Culex quinq 0.920 0.417 0.662 1e-125
157135681 937 arsenite-resistance protein [Aedes aegyp 0.920 0.332 0.672 1e-124
157135683 935 arsenite-resistance protein [Aedes aegyp 0.920 0.333 0.672 1e-124
383847249 909 PREDICTED: serrate RNA effector molecule 0.955 0.356 0.647 1e-124
380018659 919 PREDICTED: serrate RNA effector molecule 0.955 0.352 0.631 1e-123
328791253 920 PREDICTED: serrate RNA effector molecule 0.955 0.352 0.629 1e-123
350407862 920 PREDICTED: serrate RNA effector molecule 0.955 0.352 0.631 1e-122
340721924 916 PREDICTED: serrate RNA effector molecule 0.955 0.353 0.631 1e-122
350407864 914 PREDICTED: serrate RNA effector molecule 0.955 0.354 0.631 1e-122
322785389 953 hypothetical protein SINV_04615 [Solenop 0.955 0.339 0.632 1e-122
>gi|170034245|ref|XP_001844985.1| arsenite-resistance protein [Culex quinquefasciatus] gi|167875497|gb|EDS38880.1| arsenite-resistance protein [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/335 (66%), Positives = 259/335 (77%), Gaps = 23/335 (6%)

Query: 28  PRALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDV 87
           PRALHRTSSIFLRNLAP+ITK EVE +CKRY+GFLRVAIADP  +RRWFRRGWVTFRRDV
Sbjct: 314 PRALHRTSSIFLRNLAPSITKLEVEAMCKRYNGFLRVAIADPLLERRWFRRGWVTFRRDV 373

Query: 88  DIKEICWNLNNIRLRDCELGAIVNRDLSRRVRTVSGLTSLKPVVQFDMKL---------- 137
           +IKEICWNLNNIRLRDCELGAIVN+DLSRRVR V+G+T  K +V+ D+KL          
Sbjct: 374 NIKEICWNLNNIRLRDCELGAIVNKDLSRRVRPVNGITCHKTIVRSDIKLCAKIAHNLDD 433

Query: 138 --SLWTD------GQEPAQQPMSYTLSSKNPVLQNITDYLIEEASAEEEELLGKSEENTE 189
              LW D      G +  +    + L+SKNPVLQNITDYLIEEASAEE+ELLG SE   +
Sbjct: 434 KAGLWKDSTEDNNGGQGEKNGEFFGLNSKNPVLQNITDYLIEEASAEEDELLGLSEAEAK 493

Query: 190 ETE-----QVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPA 244
           +T      + D  +L VLD+LILYLR+VHSVD+YNHCEYP EDEMPNRCGIIH RG AP 
Sbjct: 494 KTTDGELVERDAQLLEVLDKLILYLRVVHSVDFYNHCEYPYEDEMPNRCGIIHARGPAPQ 553

Query: 245 SKVTPQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTD 304
           +KVT  E+ +Y  TF+ KM S ++       EE+ +LGAK  +AEVEKFI ANTQE++ D
Sbjct: 554 NKVTTNELQEYVRTFEGKMGSFLARVSTLEEEEMKKLGAKDCEAEVEKFIQANTQELAKD 613

Query: 305 KWLCPLSGKKFKGPDFIRKHIFNKHAEKVEEVKKE 339
           KWLCPLSGKKFKGPDF+RKHIFNKH EKV+EV+KE
Sbjct: 614 KWLCPLSGKKFKGPDFVRKHIFNKHGEKVDEVRKE 648




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157135681|ref|XP_001663544.1| arsenite-resistance protein [Aedes aegypti] gi|122095165|sp|Q17FR9.1|SRRT_AEDAE RecName: Full=Serrate RNA effector molecule homolog; AltName: Full=Arsenite-resistance protein 2 homolog gi|108881206|gb|EAT45431.1| AAEL003287-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157135683|ref|XP_001663545.1| arsenite-resistance protein [Aedes aegypti] gi|108881207|gb|EAT45432.1| AAEL003287-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|383847249|ref|XP_003699267.1| PREDICTED: serrate RNA effector molecule homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|380018659|ref|XP_003693243.1| PREDICTED: serrate RNA effector molecule homolog [Apis florea] Back     alignment and taxonomy information
>gi|328791253|ref|XP_396542.4| PREDICTED: serrate RNA effector molecule homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|350407862|ref|XP_003488219.1| PREDICTED: serrate RNA effector molecule homolog isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721924|ref|XP_003399363.1| PREDICTED: serrate RNA effector molecule homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|350407864|ref|XP_003488220.1| PREDICTED: serrate RNA effector molecule homolog isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|322785389|gb|EFZ12062.1| hypothetical protein SINV_04615 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
UNIPROTKB|Q5TUF1 967 Ars2 "Serrate RNA effector mol 0.554 0.194 0.580 1.1e-100
UNIPROTKB|B4KLY7980 Ars2 "Serrate RNA effector mol 0.551 0.190 0.546 5.7e-98
UNIPROTKB|Q28WQ8951 Ars2 "Serrate RNA effector mol 0.587 0.209 0.518 3.9e-97
UNIPROTKB|B4H732951 Ars2 "Serrate RNA effector mol 0.587 0.209 0.518 1.7e-96
UNIPROTKB|B3MJ69948 Ars2 "Serrate RNA effector mol 0.522 0.186 0.580 3.5e-96
UNIPROTKB|B4J4971011 Ars2 "Serrate RNA effector mol 0.522 0.175 0.552 2.2e-95
UNIPROTKB|B3N3F7947 Ars2 "Serrate RNA effector mol 0.592 0.212 0.506 3.3e-95
UNIPROTKB|B4NYV0944 Ars2 "Serrate RNA effector mol 0.522 0.187 0.558 5.4e-95
UNIPROTKB|B4II37947 Ars2 "Serrate RNA effector mol 0.522 0.186 0.546 5.2e-93
UNIPROTKB|B4QCR6947 Ars2 "Serrate RNA effector mol 0.522 0.186 0.546 6.6e-93
UNIPROTKB|Q5TUF1 Ars2 "Serrate RNA effector molecule homolog" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
 Score = 566 (204.3 bits), Expect = 1.1e-100, Sum P(2) = 1.1e-100
 Identities = 112/193 (58%), Positives = 132/193 (68%)

Query:   142 DGQEPAQQPMSYTLSSKNPVLQNITDYLIXXXXXXXXXXXXXXXXXXXXTE----QVDPN 197
             +G E  Q   S+ L SKNPVLQNITDYLI                    +E    + DP 
Sbjct:   658 NGSE-VQPEESFGLQSKNPVLQNITDYLIEEASAEEEELLGLSEDSKKVSEGELIERDPQ 716

Query:   198 VLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCS 257
             ++ VLDRLILYLRIVHSVD+YNHCEYP EDEMPNRCGIIH RG    SKV   EI +Y  
Sbjct:   717 LIEVLDRLILYLRIVHSVDFYNHCEYPYEDEMPNRCGIIHARGPPSQSKVMSNEIQEYIR 776

Query:   258 TFQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPLSGKKFKG 317
             TF+ KM+S ++   +    ++ +LGAK  +AEVEKFI ANTQE++ DKWLCPLSGKKFKG
Sbjct:   777 TFEGKMASFLTRMVDIDETDMKKLGAKDAEAEVEKFITANTQELAKDKWLCPLSGKKFKG 836

Query:   318 PDFIRKHIFNKHA 330
             PDF+RKHIFNKHA
Sbjct:   837 PDFVRKHIFNKHA 849


GO:0005515 "protein binding" evidence=IPI
GO:0005654 "nucleoplasm" evidence=ISS
GO:0031053 "primary miRNA processing" evidence=ISS
UNIPROTKB|B4KLY7 Ars2 "Serrate RNA effector molecule homolog" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|Q28WQ8 Ars2 "Serrate RNA effector molecule homolog" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B4H732 Ars2 "Serrate RNA effector molecule homolog" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|B3MJ69 Ars2 "Serrate RNA effector molecule homolog" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4J497 Ars2 "Serrate RNA effector molecule homolog" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B3N3F7 Ars2 "Serrate RNA effector molecule homolog" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4NYV0 Ars2 "Serrate RNA effector molecule homolog" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B4II37 Ars2 "Serrate RNA effector molecule homolog" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4QCR6 Ars2 "Serrate RNA effector molecule homolog" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q66I22SRRT_DANRENo assigned EC number0.56470.92620.3504yesN/A
Q99MR6SRRT_MOUSENo assigned EC number0.56710.91440.3542yesN/A
Q9BXP5SRRT_HUMANNo assigned EC number0.57610.91440.3538yesN/A
Q60436SRRT_CRIGRNo assigned EC number0.560.48370.5359yesN/A
A4IFB1SRRT_BOVINNo assigned EC number0.57310.91440.3538yesN/A
Q5R539SRRT_PONABNo assigned EC number0.57610.91440.3559yesN/A
Q9V9K7SRRT_DROMENo assigned EC number0.60470.91740.3297yesN/A
Q5TUF1SRRT_ANOGANo assigned EC number0.65390.91740.3216yesN/A
Q28WQ8SRRT_DROPSNo assigned EC number0.62090.91440.3259yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
pfam04959211 pfam04959, ARS2, Arsenite-resistance protein 2 5e-55
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-04
smart0036073 smart00360, RRM, RNA recognition motif 0.004
>gnl|CDD|218350 pfam04959, ARS2, Arsenite-resistance protein 2 Back     alignment and domain information
 Score =  178 bits (453), Expect = 5e-55
 Identities = 64/111 (57%), Positives = 85/111 (76%)

Query: 229 MPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQEPTPEELDQLGAKKTDA 288
           MPNRCGIIH RG  P +++T  E+ ++  TF+ K+  L+S  +  + EE  ++G K  + 
Sbjct: 1   MPNRCGIIHVRGPPPPNRITHGEVNEWIKTFEEKLGPLLSVKETLSEEEAKKMGRKDPEQ 60

Query: 289 EVEKFIAANTQEISTDKWLCPLSGKKFKGPDFIRKHIFNKHAEKVEEVKKE 339
           EVEKF+ ANTQE++ DKWLCPLSGKKFKGP+F+RKHIFNKH +KVEEV+KE
Sbjct: 61  EVEKFVQANTQELAKDKWLCPLSGKKFKGPEFVRKHIFNKHGDKVEEVRKE 111


Arsenite is a carcinogenic compound which can act as a co-mutagen by inhibiting DNA repair. Arsenite-resistance protein 2 is thought to play a role in arsenite resistance. Length = 211

>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
KOG2295|consensus 648 100.0
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 100.0
PF1382155 DUF4187: Domain of unknown function (DUF4187) 99.52
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.58
KOG1994|consensus268 98.2
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.13
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 97.83
smart0036272 RRM_2 RNA recognition motif. 97.74
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 97.72
smart0036071 RRM RNA recognition motif. 97.33
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 97.02
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 96.95
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 96.85
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 96.52
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.4
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 96.39
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 96.29
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 96.27
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 96.21
PLN03120260 nucleic acid binding protein; Provisional 96.13
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 96.1
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 96.07
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.0
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 95.96
COG0724306 RNA-binding proteins (RRM domain) [General functio 95.68
KOG0114|consensus124 95.64
KOG3152|consensus278 95.57
PLN03121243 nucleic acid binding protein; Provisional 95.56
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 95.42
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 95.28
PHA0061644 hypothetical protein 95.08
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 95.07
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 95.07
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 94.31
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 94.2
KOG0117|consensus506 93.77
KOG1457|consensus284 93.69
smart0035526 ZnF_C2H2 zinc finger. 93.33
smart0036170 RRM_1 RNA recognition motif. 93.24
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.16
KOG0117|consensus 506 92.98
KOG0108|consensus 435 92.57
KOG1457|consensus284 92.51
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.46
KOG0127|consensus 678 92.36
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.27
PLN03213 759 repressor of silencing 3; Provisional 92.07
KOG4206|consensus221 91.98
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 91.9
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 91.55
KOG0122|consensus270 91.26
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 91.03
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 90.96
KOG4212|consensus608 89.52
KOG0121|consensus153 88.47
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 88.04
KOG4206|consensus221 87.83
KOG0116|consensus419 87.52
KOG0533|consensus243 87.24
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 87.03
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 86.23
PHA0276855 hypothetical protein; Provisional 85.71
KOG0107|consensus195 85.48
KOG3993|consensus 500 84.89
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 84.53
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 82.68
KOG4207|consensus256 82.47
KOG0127|consensus 678 81.7
>KOG2295|consensus Back     alignment and domain information
Probab=100.00  E-value=7.7e-73  Score=565.83  Aligned_cols=304  Identities=45%  Similarity=0.747  Sum_probs=279.8

Q ss_pred             cCCCCeEEeeecCCCCCHHHHHHHHhhcCCeeEEEecCCCCCCCceEEEEEEecCcccHHHHHHhhccccccCccccccc
Q psy4687          31 LHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELGAIV  110 (339)
Q Consensus        31 lh~t~slfIk~IpP~isr~ele~~ck~~~GF~~lsLSDP~p~krf~R~GWV~f~~~~~~~~~~~~L~~~~i~d~el~~~v  110 (339)
                      +|+|++||+++|+|+||+++|+.+|+++|||+++|||++++.|+|+|+|||+|+.++||++|||+||+++++.+.+++.+
T Consensus       228 ~hke~sll~rni~Pnis~aeIe~~ck~i~~~lrfals~~~aek~~~r~lwv~fk~~~ni~~a~~aLn~irl~s~~~se~e  307 (648)
T KOG2295|consen  228 THKECSLLVRNILPNISVAEIENLCKGIPGFLRFALSTINAEKNFERRLWVTFKRGTNIKEACWALNGIRLRSNFLSESE  307 (648)
T ss_pred             hhHHHHHHHhccCCcccHHHHHHHhccCchheeeeccCchHHHHHHHHhhHhhccccchHHHHHHhhhcccccccccccc
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccccccCcccchhhhhh-hhhh--------hccccCCCCCCCCcccccCCCCccccchhhhhhhhhchhHHhhh
Q psy4687         111 NRDLSRRVRTVSGLTSLKPVVQF-DMKL--------SLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLIEEASAEEEELL  181 (339)
Q Consensus       111 ~r~~~~~~r~~~~it~~~~rl~~-Dl~~--------~L~~~~~~~~~~~~~~~~~~~np~~~~i~d~liee~s~eeeell  181 (339)
                      |+++.+|+|.+||||.|++++.+ --++        .||...  ++.++....+.++||++++|++++++|+|++|++++
T Consensus       308 n~~i~rrvr~~~Gia~~keiasn~a~k~~~lldk~irl~~~a--~~t~al~tkl~s~n~i~kni~d~l~te~S~eE~e~~  385 (648)
T KOG2295|consen  308 NPDITRRVRPINGIAKHKEIASNAAQKLKNLLDKLIRLIDRA--SQTQALVTKLSSPNPIAKNIEDRLKTEASMEEDELL  385 (648)
T ss_pred             ccCccceeccCCchhhHHHHHHHHHHhhhHHHhhhHHHhhcc--cccccchhhccCCCHHHHHHHHHhhhhcchhhhhhc
Confidence            99999999999999999999987 2222        666543  233344456889999999999999999999999999


Q ss_pred             cCCCCCcc---cccccChhHHHHHHHHHHHHHHhcceeeeccccCCCcccccccCCCCccCCCCCCCCCChhhHHHHHHH
Q psy4687         182 GKSEENTE---ETEQVDPNVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCST  258 (339)
Q Consensus       182 g~~~~~~~---~~~e~d~~l~~~LD~~i~YLR~vh~~cyyc~~ey~~~~el~~~Cp~~H~R~~~p~~~~t~~e~~~W~~~  258 (339)
                      |+++.+.-   .+.++|...++.||+|+.|||+||++|||..++|.+++.|+++||.+|+|++   +.++..++.+|.+.
T Consensus       386 gssg~e~p~eg~~~er~d~~lk~LDll~~YLr~VhslDfyn~~ey~~e~~mpnrcgl~hvR~~---~~vs~~ev~e~es~  462 (648)
T KOG2295|consen  386 GSSGPEVPIEGLTSERDDIRLKLLDLLAEYLRIVHSLDFYNSKEYESEDAMPNRCGLIHVRGK---GFVSSKEVGEEESI  462 (648)
T ss_pred             CCCCCcCccccCccccchhHHHHHHHHHHHHHHHHhcccccccccchhhhcccccCceeeccc---CCCCcccchhHHHH
Confidence            98874421   4677888999999999999999999999999999999999999999999998   35666778899999


Q ss_pred             HHHhHHhccCCCCCCChHHHHhhcCcccHHHHHHHHHhhhhhccCCeecCCC--CcccccChhhHHhhhhhcchHHHHHh
Q psy4687         259 FQNKMSSLVSSPQEPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPL--SGKKFKGPDFIRKHIFNKHAEKVEEV  336 (339)
Q Consensus       259 ~e~k~~~~l~~~~~~~~~d~~klG~k~~eeevek~v~~~~~e~~e~K~rC~~--C~KlFk~~eFV~KHI~nKH~e~v~~v  336 (339)
                      |+++++..|.....+.+++++++|.+++|+||++||++||++++++||+|++  |+|||||||||+|||++||.|||+++
T Consensus       463 f~s~le~~l~~~~~lee~eakkkg~k~~e~eve~~v~s~t~e~~kdKy~C~lsgc~KlF~gpEFvrKHi~~KH~d~leei  542 (648)
T KOG2295|consen  463 FLSDLENNLACLLELEEEEAKKKGAKDVEDEVENFVDSNTMELDKDKYLCPLSGCAKLFKGPEFVRKHINKKHKDKLEEI  542 (648)
T ss_pred             HHHHhhhcccccccchHHHHHHhcccCHHHHHHHHHHHHHHHhhcccccCCCcchHhhccCHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999975  77999999999999999999999999


Q ss_pred             hcC
Q psy4687         337 KKE  339 (339)
Q Consensus       337 ~~e  339 (339)
                      |+|
T Consensus       543 rke  545 (648)
T KOG2295|consen  543 RKE  545 (648)
T ss_pred             HHH
Confidence            975



>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>PF13821 DUF4187: Domain of unknown function (DUF4187) Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1994|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
3ax1_A358 Serrate RNA effector molecule; miRNA processing, p 5e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>3ax1_A Serrate RNA effector molecule; miRNA processing, protein binding; 2.74A {Arabidopsis thaliana} Length = 358 Back     alignment and structure
 Score =  127 bits (319), Expect = 5e-34
 Identities = 39/190 (20%), Positives = 64/190 (33%), Gaps = 14/190 (7%)

Query: 155 LSSKNPVLQNITDYLIEEASAEEEELLGKSEENTE---ETEQVDPNVLRVLDRLILYLRI 211
           L S+  + +N+      E S  E+   G +         T       + +LD L+ YL  
Sbjct: 160 LDSEKKIEENVLQGSETEKSGREKLHSGSTGPVVIIRGLTSVKGLEGVELLDTLVTYLWR 219

Query: 212 VHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQ 271
           VH +DYY   E           G+ H R     S     +  +  S F +     +    
Sbjct: 220 VHGLDYYGKVETNE------AKGLRHVRAEGKVS---DAKGDENESKFDSHWQERLKGQD 270

Query: 272 EPTPEELDQLGAKKTDAEVEKFIAANTQEISTDKWLCPLSG--KKFKGPDFIRKHIFNKH 329
                   +         ++  +     E    K+ C   G  K F   +F+ KH+  KH
Sbjct: 271 PLEVMAAKEKIDAAATEALDPHVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKH 330

Query: 330 AEKVEEVKKE 339
            E V E+  +
Sbjct: 331 TELVTELTTK 340


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
3ax1_A358 Serrate RNA effector molecule; miRNA processing, p 100.0
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.37
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.3
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.3
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.28
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.27
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.27
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.26
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.22
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.22
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.21
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.21
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.19
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.17
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.17
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.17
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.16
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.15
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.14
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.14
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.14
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.14
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.13
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.13
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.13
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.12
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.12
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.11
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.11
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.11
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.1
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.09
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.08
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.08
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.07
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.07
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.06
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.04
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.04
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.04
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.04
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.04
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.03
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.03
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.02
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.02
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.02
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.02
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.02
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.01
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.01
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.01
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.01
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.0
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 97.99
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 97.99
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 97.98
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 97.98
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 97.97
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 97.97
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 97.97
2kt5_A124 RNA and export factor-binding protein 2; chaperone 97.95
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 97.95
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 97.94
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.94
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 97.94
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 97.94
1x4e_A85 RNA binding motif, single-stranded interacting pro 97.93
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 97.92
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 97.92
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 97.92
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 97.9
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 97.9
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 97.89
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 97.88
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 97.87
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.87
2div_A99 TRNA selenocysteine associated protein; structural 97.86
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 97.86
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 97.84
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 97.84
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 97.84
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 97.83
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 97.83
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 97.82
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 97.82
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 97.82
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.81
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 97.79
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 97.78
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 97.77
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 97.76
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 97.76
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 97.76
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 97.75
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 97.74
2krb_A81 Eukaryotic translation initiation factor 3 subunit 97.74
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 97.74
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 97.73
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.72
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 97.72
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 97.72
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 97.71
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 97.7
2i2y_A150 Fusion protein consists of immunoglobin G- binding 97.7
2dis_A109 Unnamed protein product; structural genomics, RRM 97.69
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 97.68
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 97.68
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.68
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 97.68
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 97.66
1x5p_A97 Negative elongation factor E; structure genomics, 97.66
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 97.65
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 97.64
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.62
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 97.6
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.59
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 97.59
2f3j_A177 RNA and export factor binding protein 2; RRM domai 97.59
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 97.58
3n9u_C156 Cleavage and polyadenylation specificity factor S; 97.57
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.56
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 97.55
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 97.54
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 97.53
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 97.53
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 97.52
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 97.52
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.52
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 97.51
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 97.51
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.5
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 97.5
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 97.46
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 97.46
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.44
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 97.44
3q2s_C229 Cleavage and polyadenylation specificity factor S; 97.41
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.41
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 97.4
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.39
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 97.38
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 97.38
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 97.37
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.35
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 97.33
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 97.32
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 97.31
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 97.31
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 97.3
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.27
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 97.27
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.25
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 96.33
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 97.21
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 97.18
2dit_A112 HIV TAT specific factor 1 variant; structural geno 97.17
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 97.17
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 97.12
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 97.12
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 97.1
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 97.1
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 97.09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.08
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 97.07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.06
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.06
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 97.04
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 97.03
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 97.01
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 97.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 96.98
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 96.97
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 96.96
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 96.92
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 96.91
2dnl_A114 Cytoplasmic polyadenylation element binding protei 96.85
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 96.85
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 96.81
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 96.78
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 96.75
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 96.75
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 96.73
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 96.64
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 96.63
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 96.54
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 96.48
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 96.39
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 96.18
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 96.1
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 95.71
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 95.48
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 95.29
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.22
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 94.61
1paa_A30 Yeast transcription factor ADR1; transcription reg 94.5
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 94.48
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 94.47
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 94.41
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 94.41
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.8
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 93.7
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 93.64
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 93.6
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 93.54
1ard_A29 Yeast transcription factor ADR1; transcription reg 93.51
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 93.36
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 93.11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 93.03
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.02
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 92.14
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.98
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 92.94
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.94
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 92.86
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 92.83
2lv2_A85 Insulinoma-associated protein 1; structural genomi 92.74
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 91.9
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 92.69
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 92.65
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.61
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 92.59
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.53
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.36
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 92.32
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 92.23
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 92.05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 92.03
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.99
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 91.96
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 91.89
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.88
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 91.55
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 91.33
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 91.33
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 91.32
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 91.31
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.25
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 91.23
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.22
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 91.21
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 90.53
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 91.16
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 91.1
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 91.09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 91.09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 91.07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 91.03
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 91.02
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.97
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.91
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.89
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.88
2ct5_A73 Zinc finger BED domain containing protein 1; DREF 90.88
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.87
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.86
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 90.81
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 90.79
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 90.77
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 90.76
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.66
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 90.65
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.64
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 90.63
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 90.61
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 90.57
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.57
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 90.57
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.54
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.53
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.52
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.5
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.49
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 90.49
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 90.46
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 90.45
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.45
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.44
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.44
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 90.38
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 90.38
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.32
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 90.31
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.24
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.23
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.22
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.22
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.21
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.2
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.19
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.16
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 90.16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 90.1
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 90.1
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 90.03
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 90.01
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.0
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 89.98
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.98
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.96
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 89.93
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.92
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 89.89
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 89.86
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.83
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 89.81
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.79
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 89.78
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.72
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.7
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.68
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 89.68
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.64
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 89.51
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.49
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 89.47
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 89.39
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 89.31
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 89.29
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.25
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.24
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.21
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.17
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 89.15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 89.03
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 89.01
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.98
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 88.97
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.96
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 88.9
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 88.83
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 88.77
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.77
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 88.75
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 88.74
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 88.62
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 88.56
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 88.4
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 88.38
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.27
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.12
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 87.98
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 87.85
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 87.73
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 87.55
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 87.48
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 87.41
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 87.4
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 87.4
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 87.3
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 87.24
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 87.09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 87.06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 87.04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 87.03
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 86.9
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 86.7
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.69
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 86.44
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 86.37
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 86.36
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 86.19
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 86.13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 85.86
2lv2_A85 Insulinoma-associated protein 1; structural genomi 85.77
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 85.67
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 85.29
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 85.15
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 84.92
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 84.87
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 83.78
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 83.76
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 83.48
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 83.33
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 83.1
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 83.0
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 82.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 82.06
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 81.84
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 81.71
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 81.57
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 81.01
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 81.01
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 80.61
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 80.58
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.49
>3ax1_A Serrate RNA effector molecule; miRNA processing, protein binding; 2.74A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=3.4e-38  Score=307.63  Aligned_cols=196  Identities=21%  Similarity=0.227  Sum_probs=131.9

Q ss_pred             cccccCcccchhhhhhhhhh--hccccCCCCCCCCcccccCCCCccccchhhhhhhhhchhHHhhhcCCCCCcccccccC
Q psy4687         118 VRTVSGLTSLKPVVQFDMKL--SLWTDGQEPAQQPMSYTLSSKNPVLQNITDYLIEEASAEEEELLGKSEENTEETEQVD  195 (339)
Q Consensus       118 ~r~~~~it~~~~rl~~Dl~~--~L~~~~~~~~~~~~~~~~~~~np~~~~i~d~liee~s~eeeellg~~~~~~~~~~e~d  195 (339)
                      +..+|+++|+++||..||.+  +|-..+.      .+.+ +..||+.....+..-.+.+  +   .|++|....++...+
T Consensus       133 ap~~~P~~S~p~RI~~Dle~a~~Lv~kLD------~e~g-ie~n~l~~~~~~~~~~~~~--~---~~~~g~~~~~~~~~~  200 (358)
T 3ax1_A          133 APKAPSFTSDPKRILTDVEQTQALVRKLD------SEKK-IEENVLQGSETEKSGREKL--H---SGSTGPVVIIRGLTS  200 (358)
T ss_dssp             CCBCCGGGSCHHHHHHHHHHHHHHHHHHH------HHHT-CCCCTTC--------------------CCCCCEEECCSSC
T ss_pred             ccCCCCCCCcHHHHHHHHHHHHHHHHHHH------HhhC-Ccccccccccccccccccc--c---ccCCCcchhhccccc
Confidence            34688999999999999998  3332211      1112 2345554321110000000  0   111111110000011


Q ss_pred             -h--hHHHHHHHHHHHHHHhcceeeeccccCCCcccccccCCCCccCCCCCCCCCChhhHHHHHHHHHHhHHhccCCCCC
Q psy4687         196 -P--NVLRVLDRLILYLRIVHSVDYYNHCEYPNEDEMPNRCGIIHTRGSAPASKVTPQEITDYCSTFQNKMSSLVSSPQE  272 (339)
Q Consensus       196 -~--~l~~~LD~~i~YLR~vh~~cyyc~~ey~~~~el~~~Cp~~H~R~~~p~~~~t~~e~~~W~~~~e~k~~~~l~~~~~  272 (339)
                       .  ..+++||++|+|||+||+|||||+++|++      .||++|+|+|.++.   .....+|.++++.++...|+.   
T Consensus       201 ~~~l~~~~~LD~~i~YLRrVH~~dYY~~~E~~~------~~g~~HvR~~~~~~---~~~~~~we~~ld~~w~~~l~~---  268 (358)
T 3ax1_A          201 VKGLEGVELLDTLVTYLWRVHGLDYYGKVETNE------AKGLRHVRAEGKVS---DAKGDENESKFDSHWQERLKG---  268 (358)
T ss_dssp             CEEECSHHHHHHHHHHHHHHHCEEGGGTEECTT------CCSBCCBC-------------CHHHHHHHHHHHHHHHS---
T ss_pred             hhhhhhHHHHHHHHHHHHHHHcccccceEeecC------ccccCeecCCCCCC---CCchhhHHHHHHHHHHHHHcc---
Confidence             1  13799999999999999999999999985      69999999987643   224558999999998888853   


Q ss_pred             CChHHHHhhcCcccHHHHHHHHHhhhhhc-cC---CeecC--CCCcccccChhhHHhhhhhcchHHHHHhhc
Q psy4687         273 PTPEELDQLGAKKTDAEVEKFIAANTQEI-ST---DKWLC--PLSGKKFKGPDFIRKHIFNKHAEKVEEVKK  338 (339)
Q Consensus       273 ~~~~d~~klG~k~~eeevek~v~~~~~e~-~e---~K~rC--~~C~KlFk~~eFV~KHI~nKH~e~v~~v~~  338 (339)
                       .++++.++|++++|+++++||++++++. ++   |||||  ++|+|||||++||+|||+|||||+|+++++
T Consensus       269 -~dp~~~~lg~k~ie~~~~e~l~~~v~k~~dE~~gwK~~C~~~~C~KLFk~~eFV~KHi~~KH~e~v~~~~~  339 (358)
T 3ax1_A          269 -QDPLEVMAAKEKIDAAATEALDPHVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTT  339 (358)
T ss_dssp             -CCHHHHHHCHHHHHHHHHHHHGGGEEEEECSSSSEEEEECSSSCCCEESSHHHHHHHHHHHCHHHHHHHHH
T ss_pred             -cChHHHHhcCccHHHHHHHHHHHHHHHHhhcccccccCCCCCCcCcccCCHHHHHHHHHhccHHHHHHHHH
Confidence             3478899999999999999999999975 33   38999  699999999999999999999999998875



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct5_A Zinc finger BED domain containing protein 1; DREF homolog, putative C-like transposable element, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.6 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 339
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-05
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-04
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-04
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-04
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-04
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-04
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-04
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 6e-04
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-04
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 6e-04
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-04
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 7e-04
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 0.001
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 0.002
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 0.002
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 0.003
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.003
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 0.003
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 0.003
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 0.004
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 0.004
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: CBP20, 20KDa nuclear cap-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.3 bits (94), Expect = 3e-05
 Identities = 11/78 (14%), Positives = 33/78 (42%)

Query: 29  RALHRTSSIFLRNLAPTITKAEVENLCKRYSGFLRVAIADPQPDRRWFRRGWVTFRRDVD 88
           + L ++ ++++ NL+   T+ ++  L  +     ++ +   +  +      +V +    D
Sbjct: 2   KLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRAD 61

Query: 89  IKEICWNLNNIRLRDCEL 106
            +     +N  RL D  +
Sbjct: 62  AENAMRYINGTRLDDRII 79


>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.48
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.46
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.44
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.33
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.3
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.25
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.24
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.23
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.23
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.18
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.18
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.17
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.17
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.15
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.15
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.14
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.14
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.13
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.12
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.1
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.09
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.09
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.09
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.08
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.08
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.07
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.07
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.07
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.06
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.03
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.03
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.02
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.02
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.01
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 97.99
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.99
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 97.99
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 97.96
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 97.96
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 97.95
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 97.9
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 97.9
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.89
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 97.89
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.86
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.86
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 97.86
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 97.83
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.81
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.76
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 97.74
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 97.7
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 97.69
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 97.68
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.67
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.67
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.62
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 97.61
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 97.6
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.6
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 97.57
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 97.56
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 97.55
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 97.51
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 97.5
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 97.49
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 97.44
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 97.39
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 97.35
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.32
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 97.31
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 97.27
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.23
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.16
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.11
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.08
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 97.05
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.96
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 96.83
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 96.58
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 95.88
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 95.52
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 95.42
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.35
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 95.22
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 94.07
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 93.75
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 93.56
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.36
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 92.57
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.36
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 92.35
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 91.59
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 91.55
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 91.33
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.71
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 90.16
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 89.88
d2cota238 Zinc finger and SCAN domain-containing protein 16, 89.24
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 88.25
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 87.63
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 87.01
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.1
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 84.78
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 84.19
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 83.76
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 83.12
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 82.54
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 81.16
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Hu antigen D (Hud)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.48  E-value=2e-07  Score=69.45  Aligned_cols=72  Identities=17%  Similarity=0.272  Sum_probs=60.8

Q ss_pred             CeEEeeecCCCCCHHHHHHHHhhcCCeeEEEec-CCCCCCCceEEEEEEecCcccHHHHHHhhccccccCcccc
Q psy4687          35 SSIFLRNLAPTITKAEVENLCKRYSGFLRVAIA-DPQPDRRWFRRGWVTFRRDVDIKEICWNLNNIRLRDCELG  107 (339)
Q Consensus        35 ~slfIk~IpP~isr~ele~~ck~~~GF~~lsLS-DP~p~krf~R~GWV~f~~~~~~~~~~~~L~~~~i~d~el~  107 (339)
                      ++|||++||++++-++|.+++++++....+-+- |+.. .+.-..|||.|....++..|+..||+..+.+-.+.
T Consensus         3 t~l~V~nLp~~~te~~l~~~f~~~G~v~~v~i~~~~~~-~~~~g~afv~f~~~~~a~~a~~~l~g~~~~g~~l~   75 (82)
T d1fxla1           3 TNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKIT-GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK   75 (82)
T ss_dssp             SEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECTTT-CCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECE
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHhCCcccccceeeccC-CCceeeEEEEECCHHHHHHHHHHhCCCEECCEEEE
Confidence            469999999999999999999999998888774 4433 34556799999999999999999999988886554



>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure