Diaphorina citri psyllid: psy4705


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MLRRAATQTMTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHcccccccc
****AATQTMTNMIVSEDVIKIYEAN*********RELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRRAATQTMTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein unc-45 homolog A May act as co-chaperone for HSP90 (Potential). Prevents the stimulation of HSP90AB1 ATPase activity by AHSA1. Positive factor in promoting PGR function in the cell (By similarity). May be necessary for proper folding of myosin (Potential). Necessary for normal cell proliferation. Necessary for normal myotube formation and myosin accumulation during muscle cell development. May play a role in erythropoiesis in stroma cells in the spleen.confidentQ99KD5
Protein unc-45 homolog B Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain (By similarity). Plays a role in sarcomere formation during muscle cell development. Required for myoseptal integrity, myofiber attachment, motility and craniofacial development.confidentQ6DGE9
Protein unc-45 homolog A May act as co-chaperone for HSP90 (Potential). Prevents the stimulation of HSP90AB1 ATPase activity by AHSA1. Positive factor in promoting PGR function in the cell (By similarity). May be necessary for proper folding of myosin (Potential). Necessary for normal cell proliferation. Necessary for normal myotube formation and myosin accumulation during muscle cell development. May play a role in erythropoiesis in stroma cells in the spleen.confidentQ5RAP0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0051879 [MF]Hsp90 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0061077 [BP]chaperone-mediated protein foldingprobableGO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NOW, chain A
Confidence level:very confident
Coverage over the Query: 11-156
View the alignment between query and template
View the model in PyMOL