Psyllid ID: psy4705

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MLRRAATQTMTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccEEEEccccEEccccc
MLRRAATQTMTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLgitlnpevafpgerslEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRqrkklnfrpfvsclggvvvktldw
mlrraatqtmtnmivsedVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRqrkklnfrpfvsclggvvvktldw
MLRRAATQTMTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW
************MIVSEDVIKIYEAN*********RELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTL**
****AATQTMTNMIVSEDVIKI***************LLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW
********TMTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNG********AQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW
MLRRAATQTMTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRRAATQTMTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRPFVSCLGGVVVKTLDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
Q5RAP0 929 Protein unc-45 homolog A yes N/A 0.689 0.121 0.557 4e-26
Q32PZ3 944 Protein unc-45 homolog A yes N/A 0.689 0.119 0.548 4e-26
Q99KD5 944 Protein unc-45 homolog A yes N/A 0.689 0.119 0.548 5e-26
Q9H3U1 944 Protein unc-45 homolog A yes N/A 0.689 0.119 0.548 7e-26
Q68F64 927 Protein unc-45 homolog B N/A N/A 0.676 0.119 0.477 1e-23
Q6DGE9 934 Protein unc-45 homolog B yes N/A 0.664 0.116 0.504 2e-23
D7REX8 927 Protein unc-45 homolog B no N/A 0.676 0.119 0.477 3e-23
Q8CGY6 931 Protein unc-45 homolog B no N/A 0.676 0.119 0.495 4e-23
Q8IWX7 931 Protein unc-45 homolog B no N/A 0.676 0.119 0.477 2e-18
>sp|Q5RAP0|UN45A_PONAB Protein unc-45 homolog A OS=Pongo abelii GN=UNC45A PE=2 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 78/113 (69%)

Query: 30  VESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGI 89
           V + + RELL+RI  AL  + E RG +V QG  +ALI LA  GT  G+ +AAQ LA+L I
Sbjct: 643 VLTSSCRELLSRIFLALVEEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTI 702

Query: 90  TLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQR 142
           T NPE+ FPGER  EVVRPL+SLLH   + L+ FE LMAL NLA I E+ RQ+
Sbjct: 703 TSNPEMTFPGERIYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISERLRQK 755
May act as co-chaperone for HSP90 (Potential). Prevents the stimulation of HSP90AB1 ATPase activity by AHSA1. Positive factor in promoting PGR function in the cell (By similarity). May be necessary for proper folding of myosin (Potential). Necessary for normal cell proliferation. Necessary for normal myotube formation and myosin accumulation during muscle cell development. May play a role in erythropoiesis in stroma cells in the spleen.
Pongo abelii (taxid: 9601)
>sp|Q32PZ3|UN45A_RAT Protein unc-45 homolog A OS=Rattus norvegicus GN=Unc45a PE=2 SV=1 Back     alignment and function description
>sp|Q99KD5|UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus GN=Unc45a PE=1 SV=2 Back     alignment and function description
>sp|Q9H3U1|UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens GN=UNC45A PE=1 SV=1 Back     alignment and function description
>sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevis GN=unc45b PE=2 SV=1 Back     alignment and function description
>sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio GN=unc45b PE=1 SV=2 Back     alignment and function description
>sp|D7REX8|UN45B_XENTR Protein unc-45 homolog B OS=Xenopus tropicalis GN=unc45b PE=1 SV=1 Back     alignment and function description
>sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus GN=Unc45b PE=1 SV=1 Back     alignment and function description
>sp|Q8IWX7|UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens GN=UNC45B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
357628299 872 hypothetical protein KGM_14414 [Danaus p 0.634 0.119 0.666 2e-38
312378002 861 hypothetical protein AND_10529 [Anophele 0.695 0.132 0.640 2e-38
332024716 939 Protein unc-45-like protein A [Acromyrme 0.695 0.121 0.640 2e-38
307188554 939 UNC45-like protein A [Camponotus florida 0.695 0.121 0.649 7e-38
183979249 943 similar to CG2708-PA [Papilio xuthus] 0.634 0.110 0.649 7e-38
118780595 951 AGAP003727-PA [Anopheles gambiae str. PE 0.774 0.133 0.589 8e-38
242010879 944 heat shock protein 70 HSP70 interacting 0.695 0.120 0.622 9e-38
48105896 942 PREDICTED: protein unc-45 homolog A [Api 0.695 0.121 0.649 9e-38
380027387 941 PREDICTED: protein unc-45 homolog B-like 0.695 0.121 0.640 1e-37
91084547 923 PREDICTED: similar to AGAP003727-PA [Tri 0.695 0.123 0.649 1e-37
>gi|357628299|gb|EHJ77688.1| hypothetical protein KGM_14414 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 76/114 (66%), Positives = 93/114 (81%)

Query: 29  KVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLG 88
           K ES N+REL+AR+ NAL S QELRG++VQQG +K LI +A  GT  GK+QAAQ LAR+G
Sbjct: 575 KTESHNSRELIARVFNALCSLQELRGIVVQQGGAKVLIPMALEGTNNGKKQAAQALARIG 634

Query: 89  ITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQR 142
           IT+NPEVA+PG+R+LEVVRPL++LLHP+ TALE FE LMALCNLA + E  R R
Sbjct: 635 ITINPEVAYPGQRNLEVVRPLIALLHPDCTALENFEALMALCNLAGMNETTRNR 688

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312378002|gb|EFR24690.1| hypothetical protein AND_10529 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|332024716|gb|EGI64905.1| Protein unc-45-like protein A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307188554|gb|EFN73289.1| UNC45-like protein A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|183979249|dbj|BAG30786.1| similar to CG2708-PA [Papilio xuthus] Back     alignment and taxonomy information
>gi|118780595|ref|XP_310258.5| AGAP003727-PA [Anopheles gambiae str. PEST] gi|116130924|gb|EAA05979.3| AGAP003727-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|242010879|ref|XP_002426185.1| heat shock protein 70 HSP70 interacting protein, putative [Pediculus humanus corporis] gi|212510236|gb|EEB13447.1| heat shock protein 70 HSP70 interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|48105896|ref|XP_396019.1| PREDICTED: protein unc-45 homolog A [Apis mellifera] Back     alignment and taxonomy information
>gi|380027387|ref|XP_003697407.1| PREDICTED: protein unc-45 homolog B-like [Apis florea] Back     alignment and taxonomy information
>gi|91084547|ref|XP_973113.1| PREDICTED: similar to AGAP003727-PA [Tribolium castaneum] gi|270009248|gb|EFA05696.1| translocase of outer membrane 34 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
FB|FBgn0010812 947 unc-45 [Drosophila melanogaste 0.695 0.120 0.605 1.4e-30
UNIPROTKB|F1RMH7 944 UNC45A "Uncharacterized protei 0.689 0.119 0.557 6.1e-24
ZFIN|ZDB-GENE-050417-158 935 unc45a "unc-45 homolog A (C. e 0.774 0.135 0.496 7.6e-24
MGI|MGI:2142246 944 Unc45a "unc-45 homolog A (C. e 0.689 0.119 0.548 7.8e-24
RGD|1305357 944 Unc45a "unc-45 homolog A (C. e 0.689 0.119 0.548 7.8e-24
UNIPROTKB|A5PKJ5 929 UNC45A "Uncharacterized protei 0.689 0.121 0.548 9.7e-24
UNIPROTKB|Q9H3U1 944 UNC45A "Protein unc-45 homolog 0.689 0.119 0.548 1.3e-23
ZFIN|ZDB-GENE-020919-3 934 unc45b "unc-45 homolog B (C. e 0.689 0.120 0.486 2.2e-21
RGD|1305666 735 Unc45b "unc-45 homolog B (C. e 0.676 0.151 0.495 3e-21
MGI|MGI:2443377 931 Unc45b "unc-45 homolog B (C. e 0.676 0.119 0.495 4.6e-21
FB|FBgn0010812 unc-45 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 348 (127.6 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 69/114 (60%), Positives = 89/114 (78%)

Query:    29 KVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLG 88
             K ES N++EL+AR+LNA+   +ELRG +VQ+G  KAL+ +A  GT KGKR A Q LAR+G
Sbjct:   642 KTESHNSQELIARVLNAVCGLKELRGKVVQEGGVKALLRMALEGTEKGKRHATQALARIG 701

Query:    89 ITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQR 142
             IT+NPEV+F G+RSL+V+RPLL+LL  + TALE FE LMAL NLA++ E  RQR
Sbjct:   702 ITINPEVSFSGQRSLDVIRPLLNLLQQDCTALENFESLMALTNLASMNESVRQR 755
GO:0061077 "chaperone-mediated protein folding" evidence=IDA
GO:0034605 "cellular response to heat" evidence=IDA
GO:0007525 "somatic muscle development" evidence=IMP
GO:0031034 "myosin filament assembly" evidence=IMP
UNIPROTKB|F1RMH7 UNC45A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-158 unc45a "unc-45 homolog A (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2142246 Unc45a "unc-45 homolog A (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305357 Unc45a "unc-45 homolog A (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5PKJ5 UNC45A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H3U1 UNC45A "Protein unc-45 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020919-3 unc45b "unc-45 homolog B (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1305666 Unc45b "unc-45 homolog B (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443377 Unc45b "unc-45 homolog B (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9H3U1UN45A_HUMANNo assigned EC number0.54860.68900.1197yesN/A
Q99KD5UN45A_MOUSENo assigned EC number0.54860.68900.1197yesN/A
Q32PZ3UN45A_RATNo assigned EC number0.54860.68900.1197yesN/A
Q6DGE9UN45B_DANRENo assigned EC number0.50450.66460.1167yesN/A
Q5RAP0UN45A_PONABNo assigned EC number0.55750.68900.1216yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
KOG4151|consensus 748 99.42
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.12
KOG4224|consensus 550 99.01
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.99
KOG4224|consensus 550 98.95
KOG0166|consensus 514 98.67
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.62
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.47
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.23
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.2
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.12
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.08
PF04826 254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.33
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.18
KOG0166|consensus 514 96.97
PRK09687280 putative lyase; Provisional 96.9
PRK09687280 putative lyase; Provisional 96.83
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.21
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 96.03
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 95.87
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 95.5
KOG1048|consensus 717 95.39
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 95.38
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 95.11
KOG4199|consensus461 94.93
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 94.8
KOG4151|consensus748 94.61
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 94.4
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 94.21
PF05536 543 Neurochondrin: Neurochondrin 94.19
KOG2160|consensus342 93.89
KOG4199|consensus 461 93.89
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 93.71
KOG0168|consensus 1051 93.06
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 92.59
KOG1222|consensus 791 92.39
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 91.68
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 91.1
KOG1222|consensus 791 90.69
PF11701157 UNC45-central: Myosin-binding striated muscle asse 90.49
PF03224 312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 90.47
KOG2122|consensus 2195 89.96
KOG4500|consensus 604 88.39
KOG4500|consensus 604 88.17
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 87.47
COG1413 335 FOG: HEAT repeat [Energy production and conversion 86.28
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 85.51
KOG2160|consensus 342 85.37
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 84.23
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 83.54
KOG1293|consensus 678 82.64
KOG1048|consensus 717 80.76
KOG2122|consensus 2195 80.23
>KOG4151|consensus Back     alignment and domain information 
Probab=99.42  E-value=2.1e-13  Score=126.82  Aligned_cols=121  Identities=37%  Similarity=0.434  Sum_probs=101.1

Q ss_pred             cChhHHHHHHHhhcccCCHHHHHHHHHHHHHhccchhhHHHHHhcChHHHHHHHhhccchhhhhHHHHHHHHHhCcCCCC
Q psy4705          15 VSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLGITLNPE   94 (164)
Q Consensus        15 ~~~~vi~~l~v~l~k~~S~~~k~~~~~il~~Ls~~~~~R~~ivqqGai~~Ll~l~~~gt~~~~~~A~~ALakLlIs~nP~   94 (164)
                      ++.+..+.. ..+.++.+-+..|.++      |.++..|+..+|.||.+.|+.+...+++..|..+.|||+  .     .
T Consensus       466 ~~~~~~~~~-~svakt~~~~~~E~~a------A~~K~~~~~~Ik~~~~~aLlrl~~~q~e~akl~~~~aL~--~-----~  531 (748)
T KOG4151|consen  466 LSLDEDPSC-ESVAKTVSWAKNEYLA------AKEKYERAKKIKPGGYEALLRLGQQQFEEAKLKWYHALA--G-----K  531 (748)
T ss_pred             hccCcchhh-hHHHHHHHHHHHHHHh------hhhHHhcCccccccHHHHHHHHHHHhchHHHHHHHHHHh--h-----h
Confidence            334444443 2333444433444443      889999999999999999999999999999999999999  2     7


Q ss_pred             cccCCCCcccchHHHHhccCCCcchHHHHHHHHHHHcccCCChHHHHHHHhccch
Q psy4705          95 VAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRP  149 (164)
Q Consensus        95 l~f~~~~~~~av~pL~~LL~~~~~~l~~fEaLlALTNLAs~~~~~r~~Iv~~~~~  149 (164)
                      +-|+|++++++++|+.++++++..++++||+|+|||||||+++..|++|+++.|.
T Consensus       532 i~f~~~~~~~v~~~~~s~~~~d~~~~en~E~L~altnLas~s~s~r~~i~ke~~~  586 (748)
T KOG4151|consen  532 IDFPGERSYEVVKPLDSALHNDEKGLENFEALEALTNLASISESDRQKILKEKAL  586 (748)
T ss_pred             cCCCCCchhhhhhhhcchhhhhHHHHHHHHHHHHhhcccCcchhhHHHHHHHhcc
Confidence            7899999999999999999999999999999999999999999999999999884

>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
3now_A 810 Unc-45 From Drosophila Melanogaster Length = 810 9e-35
>pdb|3NOW|A Chain A, Unc-45 From Drosophila Melanogaster Length = 810 Back     alignment and structure 
Iteration: 1

 Score =  142 bits (358), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 69/114 (60%), Positives = 89/114 (78%)
Query: 29  KVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARLG 88
           K ES N++EL+AR+LNA+   +ELRG +VQ+G  KAL+ +A  GT KGKR A Q LAR+G
Sbjct: 505 KTESHNSQELIARVLNAVCGLKELRGKVVQEGGVKALLRMALEGTEKGKRHATQALARIG 564
Query: 89  ITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQR 142
           IT+NPEV+F G+RSL+V+RPLL+LL  + TALE FE LMAL NLA++ E  RQR
Sbjct: 565 ITINPEVSFSGQRSLDVIRPLLNLLQQDCTALENFESLMALTNLASMNESVRQR 618

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 1e-29
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-26
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-05
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-05
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-04
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 8e-04
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-05
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-05
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-05
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-04
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-04
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
 Score =  112 bits (281), Expect = 1e-29
 Identities = 28/130 (21%), Positives = 49/130 (37%), Gaps = 16/130 (12%)

Query: 29  KVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKG---KRQAAQGLA 85
              S N ++ + RI+  +   +     + QQGA K ++    N    G   +    + L 
Sbjct: 467 HNLSPNCKQQVVRIIYNITRSKNFIPQLAQQGAVKIILEYLANKQDIGEPIRILGCRALT 526

Query: 86  RLGITLNPEVAFPGERSLEVVRPLLSLL-------------HPEATALETFEGLMALCNL 132
           R+ I  NP + F    +L  +  L  LL               +    + +E L+AL NL
Sbjct: 527 RMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLTDNYEALLALTNL 586

Query: 133 AAIGEKQRQR 142
           A+      + 
Sbjct: 587 ASSETSDGEE 596
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 99.94
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.87
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.51
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.44
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.4
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.4
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.37
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.36
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.35
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.34
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.32
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.31
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.28
3nmz_A458 APC variant protein; protein-protein complex, arma 99.28
3nmz_A458 APC variant protein; protein-protein complex, arma 99.28
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.27
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.26
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.23
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.19
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.14
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.13
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.12
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.12
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.11
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.11
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.08
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.03
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.01
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.0
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.97
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 98.93
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 98.9
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.9
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 98.9
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.89
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 98.87
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 98.8
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.62
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.7
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.57
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.53
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 97.52
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.42
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.41
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 97.25
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.11
3grl_A 651 General vesicular transport factor P115; vesicle t 97.07
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 96.19
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 96.14
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 95.14
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 95.02
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 94.97
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 94.75
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 94.24
3grl_A 651 General vesicular transport factor P115; vesicle t 94.14
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 94.07
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 94.07
1qgr_A 876 Protein (importin beta subunit); transport recepto 94.02
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 93.83
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 92.85
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 91.26
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 90.87
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 89.37
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 89.28
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 89.04
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 86.82
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 85.61
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 84.5
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 84.27
1qgr_A 876 Protein (importin beta subunit); transport recepto 83.83
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 83.72
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.94  E-value=3.1e-27  Score=220.08  Aligned_cols=145  Identities=21%  Similarity=0.263  Sum_probs=129.1

Q ss_pred             HHHHhcChhHHHHHHHhhcccCCHHHHHHHHHHHHHhccchhhHHHHHhcChHHHHHHHhhccchh---hhhHHHHHHHH
Q psy4705          10 MTNMIVSEDVIKIYEANKDKVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVK---GKRQAAQGLAR   86 (164)
Q Consensus        10 l~nli~~~~vi~~l~v~l~k~~S~~~k~~~~~il~~Ls~~~~~R~~ivqqGai~~Ll~l~~~gt~~---~~~~A~~ALak   86 (164)
                      .|..+...|++|.| +.+.+++|+++|++++++|++||.++++|+.++||||+++|+++..++++.   .|..|++||||
T Consensus       449 ~~~~l~eaGvIp~L-v~Ll~S~s~~~re~A~~aL~nLS~d~~~R~~lvqqGal~~LL~lL~s~~~~~~~~k~~AA~ALAr  527 (778)
T 3opb_A          449 NEKYILRTELISFL-KREMHNLSPNCKQQVVRIIYNITRSKNFIPQLAQQGAVKIILEYLANKQDIGEPIRILGCRALTR  527 (778)
T ss_dssp             HHHHTTTTTHHHHH-HHHGGGSCHHHHHHHHHHHHHHHTSGGGHHHHHHTTHHHHHHHHTTCC---CCHHHHHHHHHHHH
T ss_pred             HHHHHHHCcCHHHH-HHHHcCCCHHHHHHHHHHHHHHcCCHHHHHHHHHCCCHHHHHHHHhcCCCcchHHHHHHHHHHHH
Confidence            67889999999999 899999999999999999999999999999999999999999998887654   78999999999


Q ss_pred             HhCcCCCCcccCCCCcccchHHHHhccCC--C-----------cchHHHHHHHHHHHcccCCC----hHHHHHHHhc--c
Q psy4705          87 LGITLNPEVAFPGERSLEVVRPLLSLLHP--E-----------ATALETFEGLMALCNLAAIG----EKQRQRKKLN--F  147 (164)
Q Consensus        87 LlIs~nP~l~f~~~~~~~av~pL~~LL~~--~-----------~~~l~~fEaLlALTNLAs~~----~~~r~~Iv~~--~  147 (164)
                      |+|++||.++|+|+.+.++||||++||++  +           .+.+|+|||++||||||+.+    ++.|++|+++  +
T Consensus       528 Llis~np~~~f~~~~~~~aI~pLv~LL~~~~~~~~~~l~~~~~~~~l~~feAL~ALTNLAs~~~n~~E~~r~~Ii~~~ga  607 (778)
T 3opb_A          528 MLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLTDNYEALLALTNLASSETSDGEEVCKHIVSTKVY  607 (778)
T ss_dssp             HHHTSCHHHHSSSSCSTTHHHHHHHTSCCSSSCSSCC---CCCCCHHHHHHHHHHHHHHHHCCSHHHHHHHHHHHHSHHH
T ss_pred             HHhcCCHHHHcCCCccccchHHHHHHcCCCCCcccccccccccccHHHHHHHHHHHHHHhcCCcccchHHHHHHHHhcCH
Confidence            99999999999998888999999999983  3           23488999999999999997    4689999996  7


Q ss_pred             ch-hHhhhh
Q psy4705         148 RP-FVSCLG  155 (164)
Q Consensus       148 ~~-~~~~l~  155 (164)
                      |+ ++++|.
T Consensus       608 ~~~L~~LL~  616 (778)
T 3opb_A          608 WSTIENLML  616 (778)
T ss_dssp             HHHHHHGGG
T ss_pred             HHHHHHHHh
Confidence            76 666665
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 164
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-04
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.7 bits (88), Expect = 2e-04
 Identities = 15/57 (26%), Positives = 25/57 (43%)

Query: 31  ESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAHNGTVKGKRQAAQGLARL 87
             +N + + A +L  LA  +E    +  +GA+  L  L H+        AA  L R+
Sbjct: 472 PIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRM 528

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.02
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.99
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.89
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.74
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.59
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.39
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.02
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 94.54
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 94.42
d1b3ua_588 Constant regulatory domain of protein phosphatase 94.15
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 93.36
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 93.35
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 92.52
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 87.41
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 86.54
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 85.68
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 80.11
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.22  E-value=5.8e-11  Score=100.04  Aligned_cols=149  Identities=14%  Similarity=0.044  Sum_probs=120.6

Q ss_pred             hhHHHHHHHHHHh----------cChhHHHHHHHhhc-ccCCHHHHHHHHHHHHHhccchhhHHHHHhcChHHHHHHHhh
Q psy4705           2 LRRAATQTMTNMI----------VSEDVIKIYEANKD-KVESDNTRELLARILNALASQQELRGLMVQQGASKALIHLAH   70 (164)
Q Consensus         2 ~~~aa~~~l~nli----------~~~~vi~~l~v~l~-k~~S~~~k~~~~~il~~Ls~~~~~R~~ivqqGai~~Ll~l~~   70 (164)
                      +|+.|+.+++++.          ...++++.+ +.+. +.+++..++.++.+|.+|+.+++.|..+++.||++.|+.+.+
T Consensus        33 v~~~A~~~l~~l~~~~~~~~~~~~~~~~v~~l-~~~L~~~~~~~~~~~a~~~L~~l~~~~~~~~~i~~~g~i~~Li~lL~  111 (529)
T d1jdha_          33 VVNKAAVMVHQLSKKEASRHAIMRSPQMVSAI-VRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLG  111 (529)
T ss_dssp             HHHHHHHHHHHHHTSHHHHHHHHTCHHHHHHH-HHHHHHCCCHHHHHHHHHHHHHHTTSHHHHHHHHHTTHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHhccHHHHHHHHhhhHHHHH-HHHHcCCCCHHHHHHHHHHHHHHhCCchhHHHHHHCCCHHHHHHHhC
Confidence            5788889999884          345778877 5555 456789999999999999999999999999999999999998


Q ss_pred             ccchhhhhHHHHHHHHHhCcCCCCc-ccCCCCcccchHHHHhccCCCcchHHHHHHHHHHHcccCCChHHHHHHHhccch
Q psy4705          71 NGTVKGKRQAAQGLARLGITLNPEV-AFPGERSLEVVRPLLSLLHPEATALETFEGLMALCNLAAIGEKQRQRKKLNFRP  149 (164)
Q Consensus        71 ~gt~~~~~~A~~ALakLlIs~nP~l-~f~~~~~~~av~pL~~LL~~~~~~l~~fEaLlALTNLAs~~~~~r~~Iv~~~~~  149 (164)
                      ++.++.+..|+.+|++|+.+..+.- .|.   ..++||+|+.+|+ +.+..-+.++..+|.||+..+++.+..+...+..
T Consensus       112 ~~~~~v~~~a~~aL~~l~~~~~~~~~~~~---~~g~i~~Lv~lL~-~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~~  187 (529)
T d1jdha_         112 SPVDSVLFYAITTLHNLLLHQEGAKMAVR---LAGGLQKMVALLN-KTNVKFLAITTDCLQILAYGNQESKLIILASGGP  187 (529)
T ss_dssp             CSCHHHHHHHHHHHHHHHHHCTTHHHHHH---HHTHHHHHHHGGG-CCCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTHH
T ss_pred             CCCHHHHHHHHHHHHHhhcccchhhhHHH---hcCCchHHHHHHH-ccChHHHHHHHHHHHHHhhhhhHHHHHHHhcccc
Confidence            8888899999999999987665532 221   2469999999998 5555667779999999998877778888887763


Q ss_pred             --hHhhhh
Q psy4705         150 --FVSCLG  155 (164)
Q Consensus       150 --~~~~l~  155 (164)
                        ++.+|+
T Consensus       188 ~~L~~ll~  195 (529)
T d1jdha_         188 QALVNIMR  195 (529)
T ss_dssp             HHHHHHHH
T ss_pred             hHHHHHHH
Confidence              666664
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure