Diaphorina citri psyllid: psy4717


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MKSTEDVEKVVQVAHDHNLVVNHQAIFIGTRYWCITESTEDVEKVVQVAHDHNLVIIPFGGGTNVTGAVACPENELRTIISLDTSQMQSP
cccHHHHHHHHHHHcccccccccccccccccCEECcccHHHHHHHHHHHHHcccEEEEccccccccccCCccccccEEEEEEEccccccc
*********VVQVAHDHNLVVNHQAIFIGTRYWCITESTEDVEKVVQVAHDHNLVIIPFGGGTNVTGAVACPENELRTIISLDTSQ****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSTEDVEKVVQVAHDHNLVVNHQAIFIGTRYWCITESTEDVEKVVQVAHDHNLVIIPFGGGTNVTGAVACPENELRTIISLDTSQMQSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alkyldihydroxyacetonephosphate synthase confidentQ9V778
Alkyldihydroxyacetonephosphate synthase, peroxisomal confidentQ9EQR2
Alkyldihydroxyacetonephosphate synthase, peroxisomal confidentP97275

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008609 [MF]alkylglycerone-phosphate synthase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0071949 [MF]FAD bindingprobableGO:0043168, GO:0050662, GO:0050660, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0008611 [BP]ether lipid biosynthetic processprobableGO:1901576, GO:0006629, GO:0044238, GO:0097384, GO:0071704, GO:0018904, GO:0009987, GO:0044710, GO:0044237, GO:1901503, GO:0009058, GO:0008150, GO:0044281, GO:0008152, GO:0046485, GO:0044255, GO:0008610

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4BBY, chain A
Confidence level:very confident
Coverage over the Query: 3-89
View the alignment between query and template
View the model in PyMOL