Diaphorina citri psyllid: psy471

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-

MSKLLTIVSLEDVKLRQNQPCQATDNNIGYLARSFEGPEWDYGHVRLRKSFSPRCCHHSPRLFQLLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVKLPKMLEPLLVLTLRKKKKKKKKKKKEEEEEEEEEEEGGEEEEEGGGGEEEGGGEEEEEEEEEEEEEEEEEEEE

cccEEEEEEEccHHHccccccccccccCEEEEEcccccccEEEECccccEEcccccccccccHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHcccHHcccEEEEEccHHHHHHHHHHcccccccccEEEEEEccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccHccccccccccccccHHHHHHHHHHHHHHHHcc

**KLLTIVSLEDVKLRQNQPCQATDNNIGYLARSFEGPEWDYGHVRLRKSFSPRCCHHSPRLFQLLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVKLPKMLEPLLVLTL************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSKLLTIVSLEDVKLRQNQPCQATDNNIGYLARSFEGPEWDYGHVRLRKSFSPRCCHHSPRLFQLLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVKLPKMLEPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGGGGEEExxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Heat shock protein 68		confident	O97125

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042645 [CC]	mitochondrial nucleoid	probable	GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005576 [CC]	extracellular region	probable	GO:0005575
GO:0006986 [BP]	response to unfolded protein	probable	GO:0050896, GO:0006950, GO:0035966, GO:0008150, GO:0042221, GO:0010033
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0006611 [BP]	protein export from nucleus	probable	GO:0051169, GO:0051168, GO:0016482, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0006810, GO:0006913, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B9Q, chain A
Confidence level:very confident
Coverage over the Query: 4-156
View the alignment between query and template
View the model in PyMOL