Psyllid ID: psy471
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| 11993663 | 554 | inducible heat shock 70 kDa protein, par | 0.412 | 0.157 | 0.782 | 1e-33 | |
| 347972202 | 420 | AGAP004583-PA [Anopheles gambiae str. PE | 0.412 | 0.207 | 0.782 | 1e-33 | |
| 289741399 | 639 | heat shock protein 70 [Glossina morsitan | 0.355 | 0.117 | 0.88 | 8e-33 | |
| 159592 | 502 | heat shock protein 70, hsp70A2, partial | 0.412 | 0.173 | 0.771 | 9e-33 | |
| 1170377 | 640 | RecName: Full=Heat shock protein 70 B2 g | 0.412 | 0.135 | 0.771 | 9e-33 | |
| 113208385 | 638 | heat shock protein 70 [Mamestra brassica | 0.355 | 0.117 | 0.906 | 9e-33 | |
| 312379539 | 640 | hypothetical protein AND_08586 [Anophele | 0.412 | 0.135 | 0.771 | 1e-32 | |
| 171879766 | 254 | heat shock protein 70, partial [Plodia i | 0.360 | 0.299 | 0.894 | 1e-32 | |
| 312376960 | 631 | hypothetical protein AND_11878 [Anophele | 0.412 | 0.137 | 0.771 | 1e-32 | |
| 312375481 | 640 | hypothetical protein AND_14112 [Anophele | 0.412 | 0.135 | 0.771 | 1e-32 |
| >gi|11993663|gb|AAG42838.1|AF322911_1 inducible heat shock 70 kDa protein, partial [Leptinotarsa decemlineata] | Back alignment and taxonomy information |
|---|
Score = 148 bits (374), Expect = 1e-33, Method: Compositional matrix adjust.
Identities = 72/92 (78%), Positives = 79/92 (85%), Gaps = 5/92 (5%)
Query: 48 RKSFSPRCCHHSPRLFQLLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIA 107
RK+FSP +LTKMKETAEAYLG S+RDAVITVPAYFND+QRQATKDAGAIA
Sbjct: 13 RKTFSPEEISS-----MVLTKMKETAEAYLGSSIRDAVITVPAYFNDSQRQATKDAGAIA 67
Query: 108 GLNVMRIVNEPTAAALAYGLDKNLKGERNVKL 139
GLNV+RI+NEPTAAALAYGLDKNLKGERNV +
Sbjct: 68 GLNVLRIINEPTAAALAYGLDKNLKGERNVLI 99
|
Source: Leptinotarsa decemlineata Species: Leptinotarsa decemlineata Genus: Leptinotarsa Family: Chrysomelidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|347972202|ref|XP_001688624.2| AGAP004583-PA [Anopheles gambiae str. PEST] gi|333469360|gb|EDO63976.2| AGAP004583-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|289741399|gb|ADD19447.1| heat shock protein 70 [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|159592|gb|AAC41542.1| heat shock protein 70, hsp70A2, partial [Anopheles albimanus] | Back alignment and taxonomy information |
|---|
| >gi|1170377|sp|P41827.1|HSP74_ANOAL RecName: Full=Heat shock protein 70 B2 gi|159593|gb|AAC41543.1| heat shock protein 70, hsp70A2 [Anopheles albimanus] | Back alignment and taxonomy information |
|---|
| >gi|113208385|dbj|BAF03555.1| heat shock protein 70 [Mamestra brassicae] | Back alignment and taxonomy information |
|---|
| >gi|312379539|gb|EFR25780.1| hypothetical protein AND_08586 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|171879766|gb|ACB55606.1| heat shock protein 70, partial [Plodia interpunctella] | Back alignment and taxonomy information |
|---|
| >gi|312376960|gb|EFR23904.1| hypothetical protein AND_11878 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|312375481|gb|EFR22847.1| hypothetical protein AND_14112 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| FB|FBgn0001230 | 635 | Hsp68 "Heat shock protein 68" | 0.345 | 0.114 | 0.890 | 1.3e-29 | |
| FB|FBgn0013277 | 641 | Hsp70Ba "Heat-shock-protein-70 | 0.345 | 0.113 | 0.890 | 2.8e-29 | |
| FB|FBgn0013278 | 641 | Hsp70Bb "Heat-shock-protein-70 | 0.345 | 0.113 | 0.890 | 2.8e-29 | |
| FB|FBgn0013279 | 641 | Hsp70Bc "Heat-shock-protein-70 | 0.345 | 0.113 | 0.890 | 2.8e-29 | |
| FB|FBgn0013275 | 642 | Hsp70Aa "Heat-shock-protein-70 | 0.345 | 0.113 | 0.890 | 2.8e-29 | |
| FB|FBgn0013276 | 642 | Hsp70Ab "Heat-shock-protein-70 | 0.345 | 0.113 | 0.890 | 2.8e-29 | |
| UNIPROTKB|Q9GSU4 | 643 | Hsp70Ba "Major heat shock 70 k | 0.345 | 0.113 | 0.876 | 9.8e-29 | |
| UNIPROTKB|Q9GSU7 | 644 | Hsp70Ab "Major heat shock 70 k | 0.345 | 0.113 | 0.876 | 9.9e-29 | |
| FB|FBgn0051354 | 641 | Hsp70Bbb "Hsp70Bbb" [Drosophil | 0.345 | 0.113 | 0.876 | 1.6e-28 | |
| FB|FBgn0001217 | 633 | Hsc70-2 "Heat shock protein co | 0.345 | 0.115 | 0.835 | 7e-28 |
| FB|FBgn0001230 Hsp68 "Heat shock protein 68" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 335 (123.0 bits), Expect = 1.3e-29, P = 1.3e-29
Identities = 65/73 (89%), Positives = 72/73 (98%)
Query: 65 LLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALA 124
+LTKMKETAEAYLG +V+DAVITVPAYFND+QRQATKDAGAIAG+NV+RI+NEPTAAALA
Sbjct: 120 VLTKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALA 179
Query: 125 YGLDKNLKGERNV 137
YGLDKNLKGERNV
Sbjct: 180 YGLDKNLKGERNV 192
|
|
| FB|FBgn0013277 Hsp70Ba "Heat-shock-protein-70Ba" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0013278 Hsp70Bb "Heat-shock-protein-70Bb" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0013279 Hsp70Bc "Heat-shock-protein-70Bc" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0013275 Hsp70Aa "Heat-shock-protein-70Aa" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0013276 Hsp70Ab "Heat-shock-protein-70Ab" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GSU4 Hsp70Ba "Major heat shock 70 kDa protein Ba" [Drosophila simulans (taxid:7240)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GSU7 Hsp70Ab "Major heat shock 70 kDa protein Ab" [Drosophila simulans (taxid:7240)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0051354 Hsp70Bbb "Hsp70Bbb" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0001217 Hsc70-2 "Heat shock protein cognate 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| cd10233 | 376 | cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding | 6e-47 | |
| PRK00290 | 627 | PRK00290, dnaK, molecular chaperone DnaK; Provisio | 4e-43 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 4e-41 | |
| cd10241 | 374 | cd10241, HSPA5-like_NBD, Nucleotide-binding domain | 5e-41 | |
| cd11733 | 377 | cd11733, HSPA9-like_NBD, Nucleotide-binding domain | 4e-40 | |
| cd10234 | 376 | cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d | 2e-39 | |
| PTZ00009 | 653 | PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro | 3e-38 | |
| TIGR02350 | 595 | TIGR02350, prok_dnaK, chaperone protein DnaK | 5e-37 | |
| cd10170 | 369 | cd10170, HSP70_NBD, Nucleotide-binding domain of t | 2e-35 | |
| cd10236 | 355 | cd10236, HscA_like_NBD, Nucleotide-binding domain | 6e-35 | |
| cd10235 | 339 | cd10235, HscC_like_NBD, Nucleotide-binding domain | 2e-34 | |
| cd11734 | 373 | cd11734, Ssq1_like_NBD, Nucleotide-binding domain | 1e-33 | |
| PTZ00400 | 663 | PTZ00400, PTZ00400, DnaK-type molecular chaperone; | 2e-33 | |
| PRK13411 | 653 | PRK13411, PRK13411, molecular chaperone DnaK; Prov | 3e-32 | |
| COG0443 | 579 | COG0443, DnaK, Molecular chaperone [Posttranslatio | 3e-32 | |
| PRK05183 | 616 | PRK05183, hscA, chaperone protein HscA; Provisiona | 4e-31 | |
| PRK13410 | 668 | PRK13410, PRK13410, molecular chaperone DnaK; Prov | 7e-31 | |
| TIGR01991 | 599 | TIGR01991, HscA, Fe-S protein assembly chaperone H | 2e-29 | |
| CHL00094 | 621 | CHL00094, dnaK, heat shock protein 70 | 2e-29 | |
| cd10228 | 381 | cd10228, HSPA4_like_NDB, Nucleotide-binding domain | 1e-28 | |
| PTZ00186 | 657 | PTZ00186, PTZ00186, heat shock 70 kDa precursor pr | 2e-27 | |
| PLN03184 | 673 | PLN03184, PLN03184, chloroplast Hsp70; Provisional | 3e-25 | |
| cd10230 | 388 | cd10230, HYOU1-like_NBD, Nucleotide-binding domain | 5e-20 | |
| cd10237 | 417 | cd10237, HSPA13-like_NBD, Nucleotide-binding domai | 6e-20 | |
| cd10238 | 375 | cd10238, HSPA14-like_NBD, Nucleotide-binding domai | 3e-19 | |
| PRK01433 | 595 | PRK01433, hscA, chaperone protein HscA; Provisiona | 2e-18 | |
| cd11737 | 383 | cd11737, HSPA4_NBD, Nucleotide-binding domain of H | 1e-16 | |
| cd11739 | 383 | cd11739, HSPH1_NBD, Nucleotide-binding domain of H | 3e-16 | |
| cd10232 | 386 | cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma | 4e-16 | |
| cd11738 | 383 | cd11738, HSPA4L_NBD, Nucleotide-binding domain of | 2e-14 | |
| cd11732 | 377 | cd11732, HSP105-110_like_NBD, Nucleotide-binding d | 1e-12 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 5e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 9e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-05 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 1e-05 | |
| cd10231 | 415 | cd10231, YegD_like, Escherichia coli YegD, a putat | 2e-05 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 2e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 2e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-05 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 4e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 4e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 4e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 6e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 6e-05 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 7e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 7e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 8e-05 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 9e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 1e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 1e-04 | |
| PRK15080 | 267 | PRK15080, PRK15080, ethanolamine utilization prote | 1e-04 | |
| cd10229 | 404 | cd10229, HSPA12_like_NBD, Nucleotide-binding domai | 1e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-04 | |
| cd00012 | 185 | cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- | 2e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 2e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 3e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 3e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 3e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 4e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 4e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 6e-04 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 6e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 7e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 7e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 8e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 8e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 8e-04 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 8e-04 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 9e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.001 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.001 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.001 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.001 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.001 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 0.001 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.001 | |
| pfam01698 | 382 | pfam01698, FLO_LFY, Floricaula / Leafy protein | 0.001 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.001 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.001 | |
| pfam03286 | 198 | pfam03286, Pox_Ag35, Pox virus Ag35 surface protei | 0.001 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.002 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.002 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.002 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.002 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.002 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 0.002 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.002 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.002 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.002 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.002 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.003 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.003 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.003 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 0.003 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.003 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.003 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.003 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 0.003 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 0.003 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.004 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.004 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 0.004 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.004 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 0.004 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.004 | |
| PTZ00438 | 374 | PTZ00438, PTZ00438, gamete antigen 27/25-like prot | 0.004 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 0.004 |
| >gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins | Back alignment and domain information |
|---|
Score = 158 bits (401), Expect = 6e-47
Identities = 59/72 (81%), Positives = 65/72 (90%)
Query: 66 LTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAY 125
LTKMKE AEAYLG +V +AVITVPAYFND+QRQATKDAG IAGLNV+RI+NEPTAAA+AY
Sbjct: 119 LTKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAY 178
Query: 126 GLDKNLKGERNV 137
GLDK GERNV
Sbjct: 179 GLDKKGGGERNV 190
|
This subfamily includes human HSPA1A (70-kDa heat shock protein 1A, also known as HSP72; HSPA1; HSP70I; HSPA1B; HSP70-1; HSP70-1A), HSPA1B (70-kDa heat shock protein 1B, also known as HSPA1A; HSP70-2; HSP70-1B), and HSPA1L (70-kDa heat shock protein 1-like, also known as HSP70T; hum70t; HSP70-1L; HSP70-HOM). The genes for these three HSPA1 proteins map in close proximity on the major histocompatibility complex (MHC) class III region on chromosome 6, 6p21.3. This subfamily also includes human HSPA8 (heat shock 70kDa protein 8, also known as LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; NIP71; HSPA10; the HSPA8 gene maps to 11q24.1), human HSPA2 (70-kDa heat shock protein 2, also known as HSP70-2; HSP70-3, the HSPA2 gene maps to 14q24.1), human HSPA6 (also known as heat shock 70kDa protein 6 (HSP70B') gi 94717614, the HSPA6 gene maps to 1q23.3), human HSPA7 (heat shock 70kDa protein 7 , also known as HSP70B; the HSPA7 gene maps to 1q23.3) and Saccharmoyces cerevisiae Stress-Seventy subfamily B/Ssb1p. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Associations of polymorphisms within the MHC-III HSP70 gene locus with longevity, systemic lupus erythematosus, Meniere's disease, noise-induced hearing loss, high-altitude pulmonary edema, and coronary heart disease, have been found. HSPA2 is involved in cancer cell survival, is required for maturation of male gametophytes, and is linked to male infertility. The induction of HSPA6 is a biomarker of cellular stress. HSPA8 participates in the folding and trafficking of client proteins to different subcellular compartments, and in the signal transduction and apoptosis process; it has been shown to protect cardiomyocytes against oxidative stress partly through an interaction with alpha-enolase. S. cerevisiae Ssb1p, is part of the ribosome-associated complex (RAC), it acts as a chaperone for nascent polypeptides, and is important for translation fidelity; Ssb1p is also a [PSI+] prion-curing factor. Length = 376 |
| >gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK | Back alignment and domain information |
|---|
| >gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family | Back alignment and domain information |
|---|
| >gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 | Back alignment and domain information |
|---|
| >gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 | Back alignment and domain information |
|---|
| >gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 | Back alignment and domain information |
|---|
| >gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L | Back alignment and domain information |
|---|
| >gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|216652 pfam01698, FLO_LFY, Floricaula / Leafy protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217476 pfam03286, Pox_Ag35, Pox virus Ag35 surface protein | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|185618 PTZ00438, PTZ00438, gamete antigen 27/25-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| KOG0100|consensus | 663 | 99.96 | ||
| COG0443 | 579 | DnaK Molecular chaperone [Posttranslational modifi | 99.95 | |
| PRK13411 | 653 | molecular chaperone DnaK; Provisional | 99.94 | |
| PRK13410 | 668 | molecular chaperone DnaK; Provisional | 99.94 | |
| PTZ00186 | 657 | heat shock 70 kDa precursor protein; Provisional | 99.94 | |
| PTZ00400 | 663 | DnaK-type molecular chaperone; Provisional | 99.93 | |
| PRK00290 | 627 | dnaK molecular chaperone DnaK; Provisional | 99.93 | |
| PTZ00009 | 653 | heat shock 70 kDa protein; Provisional | 99.93 | |
| TIGR02350 | 595 | prok_dnaK chaperone protein DnaK. Members of this | 99.93 | |
| TIGR01991 | 599 | HscA Fe-S protein assembly chaperone HscA. The Hea | 99.93 | |
| PLN03184 | 673 | chloroplast Hsp70; Provisional | 99.93 | |
| PRK01433 | 595 | hscA chaperone protein HscA; Provisional | 99.93 | |
| PRK05183 | 616 | hscA chaperone protein HscA; Provisional | 99.93 | |
| CHL00094 | 621 | dnaK heat shock protein 70 | 99.92 | |
| PF00012 | 602 | HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho | 99.91 | |
| KOG0102|consensus | 640 | 99.89 | ||
| PRK11678 | 450 | putative chaperone; Provisional | 99.89 | |
| KOG0101|consensus | 620 | 99.87 | ||
| KOG0104|consensus | 902 | 99.83 | ||
| KOG0103|consensus | 727 | 99.83 | ||
| TIGR02529 | 239 | EutJ ethanolamine utilization protein EutJ family | 99.67 | |
| PRK13929 | 335 | rod-share determining protein MreBH; Provisional | 99.65 | |
| PRK13928 | 336 | rod shape-determining protein Mbl; Provisional | 99.63 | |
| TIGR00904 | 333 | mreB cell shape determining protein, MreB/Mrl fami | 99.55 | |
| PRK13927 | 334 | rod shape-determining protein MreB; Provisional | 99.54 | |
| PRK13930 | 335 | rod shape-determining protein MreB; Provisional | 99.5 | |
| PF06723 | 326 | MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba | 99.46 | |
| PRK15080 | 267 | ethanolamine utilization protein EutJ; Provisional | 99.37 | |
| COG1077 | 342 | MreB Actin-like ATPase involved in cell morphogene | 99.34 | |
| COG4820 | 277 | EutJ Ethanolamine utilization protein, possible ch | 98.76 | |
| PRK09472 | 420 | ftsA cell division protein FtsA; Reviewed | 98.43 | |
| TIGR01174 | 371 | ftsA cell division protein FtsA. This bacterial ce | 98.41 | |
| cd00012 | 371 | ACTIN Actin; An ubiquitous protein involved in the | 97.94 | |
| TIGR03739 | 320 | PRTRC_D PRTRC system protein D. A novel genetic sy | 97.86 | |
| smart00268 | 373 | ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki | 97.85 | |
| COG0849 | 418 | ftsA Cell division ATPase FtsA [Cell division and | 97.83 | |
| PRK13917 | 344 | plasmid segregation protein ParM; Provisional | 97.44 | |
| PF00022 | 393 | Actin: Actin; InterPro: IPR004000 Actin [, ] is a | 97.09 | |
| PF07520 | 1002 | SrfB: Virulence factor SrfB; InterPro: IPR009216 T | 96.64 | |
| TIGR01175 | 348 | pilM type IV pilus assembly protein PilM. This pro | 96.6 | |
| PF06406 | 318 | StbA: StbA protein; InterPro: IPR009440 This entry | 96.59 | |
| PTZ00280 | 414 | Actin-related protein 3; Provisional | 96.54 | |
| PRK10719 | 475 | eutA reactivating factor for ethanolamine ammonia | 96.43 | |
| KOG0679|consensus | 426 | 96.32 | ||
| PF02541 | 285 | Ppx-GppA: Ppx/GppA phosphatase family; InterPro: I | 95.99 | |
| PTZ00004 | 378 | actin-2; Provisional | 95.93 | |
| PRK10854 | 513 | exopolyphosphatase; Provisional | 95.73 | |
| PTZ00452 | 375 | actin; Provisional | 95.61 | |
| PTZ00281 | 376 | actin; Provisional | 95.54 | |
| PTZ00466 | 380 | actin-like protein; Provisional | 95.49 | |
| PRK11031 | 496 | guanosine pentaphosphate phosphohydrolase; Provisi | 95.25 | |
| COG4457 | 1014 | SrfB Uncharacterized protein conserved in bacteria | 95.05 | |
| COG0145 | 674 | HyuA N-methylhydantoinase A/acetone carboxylase, b | 95.04 | |
| PF08841 | 332 | DDR: Diol dehydratase reactivase ATPase-like domai | 94.89 | |
| TIGR03706 | 300 | exo_poly_only exopolyphosphatase. It appears that | 94.8 | |
| COG0248 | 492 | GppA Exopolyphosphatase [Nucleotide transport and | 94.64 | |
| PF01968 | 290 | Hydantoinase_A: Hydantoinase/oxoprolinase; InterPr | 94.3 | |
| KOG0797|consensus | 618 | 93.89 | ||
| PLN02666 | 1275 | 5-oxoprolinase | 90.05 | |
| PF11104 | 340 | PilM_2: Type IV pilus assembly protein PilM;; PDB: | 88.52 | |
| COG5277 | 444 | Actin and related proteins [Cytoskeleton] | 87.77 | |
| TIGR03123 | 318 | one_C_unchar_1 probable H4MPT-linked C1 transfer p | 84.15 | |
| TIGR00744 | 318 | ROK_glcA_fam ROK family protein (putative glucokin | 82.69 | |
| COG2069 | 403 | CdhD CO dehydrogenase/acetyl-CoA synthase delta su | 82.65 | |
| cd06007 | 59 | R3H_DEXH_helicase R3H domain of a group of protein | 80.61 | |
| PF08735 | 254 | DUF1786: Putative pyruvate format-lyase activating | 80.54 |
| >KOG0100|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=6.9e-30 Score=230.43 Aligned_cols=136 Identities=51% Similarity=0.687 Sum_probs=120.2
Q ss_pred HhhhcccCcccchhhHhhhhhcCCCCC------------ccccee--------------cceeeccccCCCchHHHHHHH
Q psy471 14 KLRQNQPCQATDNNIGYLARSFEGPEW------------DYGHVR--------------LRKSFSPRCCHHSPRLFQLLT 67 (211)
Q Consensus 14 ~~a~~~~~~~p~n~~~~l~r~~~g~~~------------~~~~~~--------------~~k~~speel~~~~~~a~iL~ 67 (211)
..++++...+|.|.++-.+|.+ |+.| +|..+. ..|.|+|++| ++|+|.
T Consensus 85 dAAKNQ~~~NPenTiFD~KRLI-Gr~~~d~~vq~Dik~~Pfkvv~k~~kp~i~v~v~~g~~K~FtPeEi-----SaMiL~ 158 (663)
T KOG0100|consen 85 DAAKNQLTSNPENTIFDAKRLI-GRKFNDKSVQKDIKFLPFKVVNKDGKPYIQVKVGGGETKVFTPEEI-----SAMILT 158 (663)
T ss_pred hHhhcccccCcccceechHHHh-CcccCChhhhhhhhcCceEEEcCCCCccEEEEccCCcccccCHHHH-----HHHHHH
Confidence 5677888889999887776666 5543 232221 2689999999 999999
Q ss_pred HHHHHHHHhhccccceeeEccCCCccHHHHHHHHHHHHHhCCceeEEeechhHHHHHcccccCCCCCceEEEeecCCCce
Q psy471 68 KMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVKLPKMLEPLL 147 (211)
Q Consensus 68 ~L~~~a~~~~g~~~~~vVItVPa~f~~~qR~al~~Aa~~aGl~~~~lv~EP~AAAl~y~~~~~~~~~~~vLV~D~GggT~ 147 (211)
+++++|+.++|..+.++|+||||||+++||+++++|..+||++++||||+|+|||++||+++. ...++|||||+|||||
T Consensus 159 KMKe~AEayLGkkv~~AVvTvPAYFNDAQrQATKDAGtIAgLnV~RIiNePTaAAIAYGLDKk-~gEknilVfDLGGGTF 237 (663)
T KOG0100|consen 159 KMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKK-DGEKNILVFDLGGGTF 237 (663)
T ss_pred HHHHHHHHHhCCcccceEEecchhcchHHHhhhcccceeccceEEEeecCccHHHHHhccccc-CCcceEEEEEcCCceE
Confidence 999999999999999999999999999999999999999999999999999999999999987 5688999999999999
Q ss_pred EEEEEeccc
Q psy471 148 VLTLRKKKK 156 (211)
Q Consensus 148 Dvsv~~~~~ 156 (211)
|+|++.++-
T Consensus 238 DVSlLtIdn 246 (663)
T KOG0100|consen 238 DVSLLTIDN 246 (663)
T ss_pred EEEEEEEcC
Confidence 999998764
|
|
| >COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13411 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK13410 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PTZ00186 heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00400 DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK00290 dnaK molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PTZ00009 heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02350 prok_dnaK chaperone protein DnaK | Back alignment and domain information |
|---|
| >TIGR01991 HscA Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >PLN03184 chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >PRK01433 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >PRK05183 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >CHL00094 dnaK heat shock protein 70 | Back alignment and domain information |
|---|
| >PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins | Back alignment and domain information |
|---|
| >KOG0102|consensus | Back alignment and domain information |
|---|
| >PRK11678 putative chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG0101|consensus | Back alignment and domain information |
|---|
| >KOG0104|consensus | Back alignment and domain information |
|---|
| >KOG0103|consensus | Back alignment and domain information |
|---|
| >TIGR02529 EutJ ethanolamine utilization protein EutJ family protein | Back alignment and domain information |
|---|
| >PRK13929 rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
| >PRK13928 rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >TIGR00904 mreB cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >PRK13927 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PRK13930 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes | Back alignment and domain information |
|---|
| >PRK15080 ethanolamine utilization protein EutJ; Provisional | Back alignment and domain information |
|---|
| >COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09472 ftsA cell division protein FtsA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01174 ftsA cell division protein FtsA | Back alignment and domain information |
|---|
| >cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton | Back alignment and domain information |
|---|
| >TIGR03739 PRTRC_D PRTRC system protein D | Back alignment and domain information |
|---|
| >smart00268 ACTIN Actin | Back alignment and domain information |
|---|
| >COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13917 plasmid segregation protein ParM; Provisional | Back alignment and domain information |
|---|
| >PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton | Back alignment and domain information |
|---|
| >PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01175 pilM type IV pilus assembly protein PilM | Back alignment and domain information |
|---|
| >PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] | Back alignment and domain information |
|---|
| >PTZ00280 Actin-related protein 3; Provisional | Back alignment and domain information |
|---|
| >PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional | Back alignment and domain information |
|---|
| >KOG0679|consensus | Back alignment and domain information |
|---|
| >PF02541 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: IPR003695 Exopolyphosphate phosphatase (Ppx) 3 | Back alignment and domain information |
|---|
| >PTZ00004 actin-2; Provisional | Back alignment and domain information |
|---|
| >PRK10854 exopolyphosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00452 actin; Provisional | Back alignment and domain information |
|---|
| >PTZ00281 actin; Provisional | Back alignment and domain information |
|---|
| >PTZ00466 actin-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] | Back alignment and domain information |
|---|
| >COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ] | Back alignment and domain information |
|---|
| >TIGR03706 exo_poly_only exopolyphosphatase | Back alignment and domain information |
|---|
| >COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01968 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3 | Back alignment and domain information |
|---|
| >KOG0797|consensus | Back alignment and domain information |
|---|
| >PLN02666 5-oxoprolinase | Back alignment and domain information |
|---|
| >PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A | Back alignment and domain information |
|---|
| >COG5277 Actin and related proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein | Back alignment and domain information |
|---|
| >TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase) | Back alignment and domain information |
|---|
| >COG2069 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases | Back alignment and domain information |
|---|
| >PF08735 DUF1786: Putative pyruvate format-lyase activating enzyme (DUF1786); InterPro: IPR014846 This family is annotated as pyruvate formate-lyase activating enzyme (1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 211 | ||||
| 3jxu_A | 409 | Crystal Structure Of The Human 70kda Heat Shock Pro | 2e-29 | ||
| 2e8a_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 2e-29 | ||
| 2e88_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 2e-29 | ||
| 3a8y_A | 392 | Crystal Structure Of The Complex Between The Bag5 B | 2e-29 | ||
| 3d2f_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 2e-29 | ||
| 1s3x_A | 382 | The Crystal Structure Of The Human Hsp70 Atpase Dom | 2e-29 | ||
| 1hjo_A | 380 | Atpase Domain Of Human Heat Shock 70kda Protein 1 L | 2e-29 | ||
| 3fe1_A | 403 | Crystal Structure Of The Human 70kda Heat Shock Pro | 2e-29 | ||
| 1yuw_A | 554 | Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 | 3e-29 | ||
| 3c7n_B | 554 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 3e-29 | ||
| 3gdq_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 4e-29 | ||
| 1ba1_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 5e-29 | ||
| 2qw9_B | 394 | Crystal Structure Of Bovine Hsc70 (1-394aa)in The A | 5e-29 | ||
| 1ba0_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 5e-29 | ||
| 1kax_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71m | 5e-29 | ||
| 1ngg_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 5e-29 | ||
| 1ngc_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 5e-29 | ||
| 1nge_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 5e-29 | ||
| 1bup_A | 386 | T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot | 5e-29 | ||
| 1hpm_A | 386 | How Potassium Affects The Activity Of The Molecular | 5e-29 | ||
| 1ngd_A | 386 | Structural Basis Of The 70-kilodalton Heat Shock Co | 5e-29 | ||
| 1ngf_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 5e-29 | ||
| 1ngh_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 5e-29 | ||
| 2bup_A | 381 | T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 | 5e-29 | ||
| 3cqx_A | 386 | Chaperone Complex Length = 386 | 6e-29 | ||
| 1hx1_A | 400 | Crystal Structure Of A Bag Domain In Complex With T | 6e-29 | ||
| 1ats_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 6e-29 | ||
| 1kaz_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71e | 6e-29 | ||
| 1atr_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 6e-29 | ||
| 2v7z_A | 543 | Crystal Structure Of The 70-Kda Heat Shock Cognate | 6e-29 | ||
| 1kay_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71a | 6e-29 | ||
| 3fzf_A | 381 | Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP | 6e-29 | ||
| 3kvg_A | 400 | Crystal Structure Of The N-Terminal Domain Of Hsp70 | 8e-29 | ||
| 3ldl_A | 384 | Crystal Structure Of Human Grp78 (70kda Heat Shock | 8e-29 | ||
| 3iuc_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 9e-29 | ||
| 1qqn_A | 378 | D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 1e-28 | ||
| 1qqm_A | 378 | D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 1e-28 | ||
| 3d2e_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 1e-28 | ||
| 1ngb_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-28 | ||
| 1nga_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 2e-28 | ||
| 1qqo_A | 378 | E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 5e-28 | ||
| 2qwn_A | 394 | Crystal Structure Of Disulfide-Bond-Crosslinked Com | 8e-28 | ||
| 3i33_A | 404 | Crystal Structure Of The Human 70kda Heat Shock Pro | 1e-26 | ||
| 4fsv_A | 387 | Crystal Structure Of A Heat Shock 70kda Protein 2 ( | 9e-26 | ||
| 3gl1_A | 387 | Crystal Structure Of Atpase Domain Of Ssb1 Chaperon | 3e-25 | ||
| 3qfp_A | 390 | Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D | 4e-25 | ||
| 3qfu_A | 394 | Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE | 4e-25 | ||
| 2kho_A | 605 | Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP | 6e-25 | ||
| 1dkg_D | 383 | Crystal Structure Of The Nucleotide Exchange Factor | 1e-24 | ||
| 4b9q_A | 605 | Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L | 5e-24 | ||
| 2v7y_A | 509 | Crystal Structure Of The Molecular Chaperone Dnak F | 7e-22 | ||
| 2qxl_A | 658 | Crystal Structure Analysis Of Sse1, A Yeast Hsp110 | 6e-08 | ||
| 3c7n_A | 668 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 7e-08 | ||
| 3d2e_A | 675 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 7e-08 | ||
| 3d2f_A | 675 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 7e-08 | ||
| 4gni_A | 409 | Structure Of The Ssz1 Atpase Bound To Atp And Magne | 4e-05 |
| >pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 | Back alignment and structure |
|
| >pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 | Back alignment and structure |
| >pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 | Back alignment and structure |
| >pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 | Back alignment and structure |
| >pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 | Back alignment and structure |
| >pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 | Back alignment and structure |
| >pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 | Back alignment and structure |
| >pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 | Back alignment and structure |
| >pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 | Back alignment and structure |
| >pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 | Back alignment and structure |
| >pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 | Back alignment and structure |
| >pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 | Back alignment and structure |
| >pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 | Back alignment and structure |
| >pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 | Back alignment and structure |
| >pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 | Back alignment and structure |
| >pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 | Back alignment and structure |
| >pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 | Back alignment and structure |
| >pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 | Back alignment and structure |
| >pdb|3CQX|A Chain A, Chaperone Complex Length = 386 | Back alignment and structure |
| >pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 | Back alignment and structure |
| >pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 | Back alignment and structure |
| >pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 | Back alignment and structure |
| >pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 | Back alignment and structure |
| >pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 | Back alignment and structure |
| >pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 | Back alignment and structure |
| >pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 | Back alignment and structure |
| >pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 | Back alignment and structure |
| >pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 | Back alignment and structure |
| >pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 | Back alignment and structure |
| >pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 | Back alignment and structure |
| >pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 | Back alignment and structure |
| >pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 | Back alignment and structure |
| >pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 | Back alignment and structure |
| >pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 | Back alignment and structure |
| >pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 | Back alignment and structure |
| >pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 | Back alignment and structure |
| >pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 | Back alignment and structure |
| >pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 | Back alignment and structure |
| >pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 | Back alignment and structure |
| >pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 | Back alignment and structure |
| >pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 | Back alignment and structure |
| >pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| 4b9q_A | 605 | Chaperone protein DNAK; HET: ATP; 2.40A {Escherich | 99.92 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 99.92 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 99.91 | |
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 99.9 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 99.9 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 99.9 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 99.89 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 99.89 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 99.86 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 99.67 | |
| 2fsj_A | 346 | Hypothetical protein TA0583; actin homologs, archa | 99.47 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 99.26 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 99.07 | |
| 2ych_A | 377 | Competence protein PILM; cell cycle, type IV pilus | 99.01 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 98.98 | |
| 4a2a_A | 419 | Cell division protein FTSA, putative; cell cycle, | 98.77 | |
| 2zgy_A | 320 | Plasmid segregation protein PARM; plasmid partitio | 98.56 | |
| 3js6_A | 355 | Uncharacterized PARM protein; partition, segregati | 98.51 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 98.33 | |
| 3dwl_A | 427 | Actin-related protein 3; propellor, actin-binding, | 97.81 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 97.65 | |
| 4am6_A | 655 | Actin-like protein ARP8; nuclear protein, chromati | 97.59 | |
| 4apw_A | 329 | ALP12; actin-like protein; 19.70A {Clostridium tet | 97.45 | |
| 4fo0_A | 593 | Actin-related protein 8; chromatin remodeling, nuc | 97.19 | |
| 4ehu_A | 276 | Activator of 2-hydroxyisocaproyl-COA dehydratase; | 97.11 | |
| 1t6c_A | 315 | Exopolyphosphatase; alpha/beta protein, actin-like | 96.4 | |
| 2d0o_A | 610 | DIOL dehydratase-reactivating factor large subunit | 96.37 | |
| 1nbw_A | 607 | Glycerol dehydratase reactivase alpha subunit; mol | 96.17 | |
| 3mdq_A | 315 | Exopolyphosphatase; structural genomics, joint cen | 95.77 | |
| 3cer_A | 343 | Possible exopolyphosphatase-like protein; NESG, BL | 94.99 | |
| 1u6z_A | 513 | Exopolyphosphatase; alpha/beta protein, askha (ace | 94.46 | |
| 3hi0_A | 508 | Putative exopolyphosphatase; 17739545, structural | 94.44 | |
| 3cj1_A | 456 | Ectonucleoside triphosphate diphosphohydrolase 2; | 89.44 | |
| 3aap_A | 353 | Ectonucleoside triphosphate diphosphohydrolase I; | 86.24 | |
| 3zx3_A | 452 | Ectonucleoside triphosphate diphosphohydrolase 1; | 86.17 | |
| 3r8e_A | 321 | Hypothetical sugar kinase; ribonuclease H-like mot | 81.44 | |
| 2qm1_A | 326 | Glucokinase; alpha-beta structure, putative helix- | 80.4 |
| >4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D | Back alignment and structure |
|---|
Probab=99.92 E-value=1.8e-25 Score=212.36 Aligned_cols=147 Identities=41% Similarity=0.550 Sum_probs=122.4
Q ss_pred ccceehhhh------HHhhhcccCcccchhhHhhhhhcCCCC-----------Cccc----------ceecceeeccccC
Q psy471 4 LLTIVSLED------VKLRQNQPCQATDNNIGYLARSFEGPE-----------WDYG----------HVRLRKSFSPRCC 56 (211)
Q Consensus 4 ~~~~~s~~~------~~~a~~~~~~~p~n~~~~l~r~~~g~~-----------~~~~----------~~~~~k~~speel 56 (211)
+.|+++|.. ...|.++...+|.|.+..++|.++.+. +++. ....++.|+|++|
T Consensus 36 ~PS~V~~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~~~d~~v~~~~~~~p~~~~~~~~g~~~~~~~~~~~~p~ei 115 (605)
T 4b9q_A 36 TPSIIAYTQDGCTLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQI 115 (605)
T ss_dssp EECCEEECTTSCEEESHHHHHTTTTCGGGEECCGGGTTTCBTTSHHHHHHHTTCSSEEEECTTSBEEEEETTEEECHHHH
T ss_pred cceEEEEeCCCcEEecHHHHHHHHhCCCcEehhhHHhhCCCCCCHHHHHHhhcCCeEEEEcCCCceEEEECCEEECHHHH
Confidence 445666642 234666677788888877777664331 1211 2235789999999
Q ss_pred CCchHHHHHHHHHHHHHHHhhccccceeeEccCCCccHHHHHHHHHHHHHhCCceeEEeechhHHHHHcccccCCCCCce
Q psy471 57 HHSPRLFQLLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERN 136 (211)
Q Consensus 57 ~~~~~~a~iL~~L~~~a~~~~g~~~~~vVItVPa~f~~~qR~al~~Aa~~aGl~~~~lv~EP~AAAl~y~~~~~~~~~~~ 136 (211)
++++|++|++.|..++|.++..+|||||++|++.||+++++||..||+++++||+||+|||++|++.+. ..+.+
T Consensus 116 -----~a~iL~~lk~~ae~~lg~~v~~~VITVPa~f~~~qr~a~~~Aa~~AGl~v~~li~EP~AAAlaygl~~~-~~~~~ 189 (605)
T 4b9q_A 116 -----SAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKG-TGNRT 189 (605)
T ss_dssp -----HHHHHHHHHHHHHHHHTSCCCEEEEEECTTCCHHHHHHHHHHHHHTTCEEEEEEEHHHHHHHHHHTTSC-CSSEE
T ss_pred -----HHHHHHHHHHHHHHHhCCCCCeEEEEECCCCCHHHHHHHHHHHHHcCCceEEEeCcHHHHHHHhhhhcc-CCCCE
Confidence 999999999999999999999999999999999999999999999999999999999999999998875 35789
Q ss_pred EEEeecCCCceEEEEEeccc
Q psy471 137 VKLPKMLEPLLVLTLRKKKK 156 (211)
Q Consensus 137 vLV~D~GggT~Dvsv~~~~~ 156 (211)
+|||||||||||+|++++.+
T Consensus 190 vlV~DlGGGT~Dvsi~~~~~ 209 (605)
T 4b9q_A 190 IAVYDLGGGAFDISIIEIDE 209 (605)
T ss_dssp EEEEEECSSCEEEEEEEEEE
T ss_pred EEEEECCCCeEEEEEEEEec
Confidence 99999999999999999865
|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A | Back alignment and structure |
|---|
| >3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* | Back alignment and structure |
|---|
| >4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} | Back alignment and structure |
|---|
| >4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A | Back alignment and structure |
|---|
| >1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* | Back alignment and structure |
|---|
| >2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A | Back alignment and structure |
|---|
| >1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 | Back alignment and structure |
|---|
| >3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} | Back alignment and structure |
|---|
| >1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* | Back alignment and structure |
|---|
| >3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3cj1_A Ectonucleoside triphosphate diphosphohydrolase 2; alpha/beta protein, actin-like fold, alternative splicing, calcium, glycoprotein, magnesium; 1.70A {Rattus norvegicus} PDB: 3cj7_A* 3cj9_A* 3cja_A* | Back alignment and structure |
|---|
| >3aap_A Ectonucleoside triphosphate diphosphohydrolase I; adenosine triphosphatase, ntpdase; 1.60A {Legionella pneumophila} PDB: 3aaq_A* 3aar_A* | Back alignment and structure |
|---|
| >3zx3_A Ectonucleoside triphosphate diphosphohydrolase 1; domain rotation, purinergic signaling; 1.70A {Rattus norvegicus} PDB: 3zx2_A* 3zx0_A* | Back alignment and structure |
|---|
| >3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 211 | ||||
| d1dkgd1 | 183 | c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas | 8e-35 | |
| d1bupa1 | 185 | c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas | 1e-30 | |
| d1jcea1 | 137 | c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB | 2e-20 |
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Escherichia coli, gene dnaK [TaxId: 562]
Score = 119 bits (300), Expect = 8e-35
Identities = 53/66 (80%), Positives = 57/66 (86%)
Query: 65 LLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALA 124
+L KMK+TAE YLG V +AVITVPAYFNDAQRQATKDAG IAGL V RI+NEPTAAALA
Sbjct: 117 VLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALA 176
Query: 125 YGLDKN 130
YGLDK
Sbjct: 177 YGLDKG 182
|
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| d1dkgd1 | 183 | Heat shock protein 70kDa, ATPase fragment {Escheri | 99.83 | |
| d1bupa1 | 185 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 99.83 | |
| d1jcea1 | 137 | Prokaryotic actin homolog MreB {Thermotoga maritim | 99.6 | |
| d1jcea2 | 196 | Prokaryotic actin homolog MreB {Thermotoga maritim | 97.45 | |
| d1bupa2 | 193 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 97.45 | |
| d1dkgd2 | 198 | Heat shock protein 70kDa, ATPase fragment {Escheri | 97.42 | |
| d2zgya2 | 163 | Plasmid segregation protein ParM {Escherichia coli | 96.56 | |
| d2fsja1 | 161 | Hypothetical protein Ta0583 {Archaeon Thermoplasma | 96.29 | |
| d2d0oa3 | 203 | Diol dehydratase-reactivating factor large subunit | 91.7 | |
| d1t6ca2 | 180 | Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 | 91.58 | |
| d1nbwa3 | 202 | ATPase domain of the glycerol dehydratase reactiva | 91.29 | |
| d1u6za3 | 177 | Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 | 91.07 | |
| d1e4ft2 | 191 | Cell division protein FtsA {Thermotoga maritima [T | 88.8 | |
| d2fxua1 | 140 | Actin {Cow (Bos taurus) [TaxId: 9913]} | 81.38 |
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Escherichia coli, gene dnaK [TaxId: 562]
Probab=99.83 E-value=2.4e-21 Score=155.80 Aligned_cols=109 Identities=53% Similarity=0.733 Sum_probs=91.1
Q ss_pred hhcccCcccchhhHhhhhhcCCCCC------------cc----------cceecceeeccccCCCchHHHHHHHHHHHHH
Q psy471 16 RQNQPCQATDNNIGYLARSFEGPEW------------DY----------GHVRLRKSFSPRCCHHSPRLFQLLTKMKETA 73 (211)
Q Consensus 16 a~~~~~~~p~n~~~~l~r~~~g~~~------------~~----------~~~~~~k~~speel~~~~~~a~iL~~L~~~a 73 (211)
+..+...+|.+.+..++|.+ |+.+ ++ .....++.|+|++| ++++|++|++.|
T Consensus 52 A~~~~~~~p~~~i~~~Krll-G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~l-----~a~~L~~l~~~a 125 (183)
T d1dkgd1 52 AKRQAVTNPQNTLFAIKRLI-GRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQI-----SAEVLKKMKKTA 125 (183)
T ss_dssp HHTTSTTCGGGEEECGGGTT-TCBSCSHHHHHHTTTCSSEEEECSSSBEEEEETTEEECHHHH-----HHHHHHHHHHHH
T ss_pred HHHhhhcCCccEEeeeHHHc-CCCCCcHHHHhhhhcCCEEEEEcCCCcEEEEECCEEECHHHH-----HHHHHHHHHHHH
Confidence 44555567777777777766 3321 11 12234788999999 999999999999
Q ss_pred HHhhccccceeeEccCCCccHHHHHHHHHHHHHhCCceeEEeechhHHHHHcccccC
Q psy471 74 EAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKN 130 (211)
Q Consensus 74 ~~~~g~~~~~vVItVPa~f~~~qR~al~~Aa~~aGl~~~~lv~EP~AAAl~y~~~~~ 130 (211)
++++|.++.++|||||++|++.||++|++||+.||+++++||+||+|||++|++.+.
T Consensus 126 ~~~~~~~~~~~VitVPa~f~~~~r~~l~~Aa~~AG~~~~~li~EP~AAAl~Ygl~k~ 182 (183)
T d1dkgd1 126 EDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKG 182 (183)
T ss_dssp HHHHSSCCCEEEECBCTTCCHHHHHHHHHHHHHTTCEESCCCBHHHHHHHHHTCCC-
T ss_pred HHHhCCCCCeEEEEECCCCCHHHHHHHHHHHHHcCCCEEEEecCHHHHHHHhcccCC
Confidence 999999999999999999999999999999999999999999999999999998764
|
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} | Back information, alignment and structure |
|---|
| >d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|