Diaphorina citri psyllid: psy4725

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------
MSLGNTVHHLSGKILCPAIELSLTLTLLGGQSFRWKQLTSDEKKLGNRFQGVFKECVWTLWADPSYLHYQVFSQHKLNANSVETMLKEYFRLDENLPELYAEWSNRDAFFRQTCGDFVGIRMLNQDLTENIFSFLCSSNNNIARISGMIDKMCKEYGTLICTLDSDGNLVGDCEKGRSHAKSCPAVTKFFAFPSIDALARPAVEAKLRQLGFGYRAKFIQKSAEYIIQGGGESWLERLGGKSYEEAREELQRLPGIGAKVGDGVFKEHVWTLWADPSYLHYQVYSQHKLNTNSVETMLKEYFRLDENLPELYAEWSNRDAFFRQTCGDFVADCICLMSLSHLQAVPVDTHVYQIACNHYHFQKSTSKTLTPAVYNQIRAFFADKFGKYAGWAHSILFCADLKKFQAKPGEEKVGKRESGTITETPGAVIEKSGKVIEAKPKIDEDKRKSEIILQSKN
ccccccccccccEECcccccccHHHHHHccccccEEEccccccccccEEEEEEccEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHcccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccc
*******HHLSGKILCPAIELSLTLTLLGGQSFRWKQLTSDEKKLGNRFQGVFKECVWTLWADPSYLHYQVFSQHKLNANSVETMLKEYFRLDENLPELYAEWSNRDAFFRQTCGDFVGIRMLNQDLTENIFSFLCSSNNNIARISGMIDKMCKEYGTLICTLDSDGNLVGDCEKGRSHAKSCPAVTKFFAFPSIDALARPAVEAKLRQLGFGYRAKFIQKSAEYIIQGGGESWLERLGGKSYEEAREELQRLPGIGAKVGDGVFKEHVWTLWADPSYLHYQVYSQHKLNTNSVETMLKEYFRLDENLPELYAEWSNRDAFFRQTCGDFVADCICLMSLSHLQAVPVDTHVYQIACNHYHFQKSTSKTLTPAVYNQIRAFFADKFGKYAGWAHSILFCADLKKF*****************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLGNTVHHLSGKILCPAIELSLTLTLLGGQSFRWKQLTSDEKKLGNRFQGVFKECVWTLWADPSYLHYQVFSQHKLNANSVETMLKEYFRLDENLPELYAEWSNRDAFFRQTCGDFVGIRMLNQDLTENIFSFLCSSNNNIARISGMIDKMCKEYGTLICTLDSDGNLVGDCEKGRSHAKSCPAVTKFFAFPSIDALARPAVEAKLRQLGFGYRAKFIQKSAEYIIQGGGESWLERLGGKSYEEAREELQRLPGIGAKVGDGVFKEHVWTLWADPSYLHYQVYSQHKLNTNSVETMLKEYFRLDENLPELYAEWSNRDAFFRQTCGDFVADCICLMSLSHLQAVPVDTHVYQIACNHYHFQKSTSKTLTPAVYNQIRAFFADKFGKYAGWAHSILFCADLKKFQAKPGEEKVGKRESGTITETPGAVIEKSGKVIEAKPKIDEDKRKSEIILQSKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-glycosylase/DNA lyase DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.confidentO70249
N-glycosylase/DNA lyase DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.confidentO08760
N-glycosylase/DNA lyase DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion. Efficiently incises DNA duplexes containing 8-hydroxyguanine (8-OH-Gua), 8-hydroxyadenine (8-OH-Ade) and abasic (AP) sites placed opposite to a cytosine.confidentQ9V3I8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050896 [BP]response to stimulusprobableGO:0008150

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.2.-.-Carbon-oxygen lyases.probable
4.2.99.-Other carbon-oxygen lyases.probable
4.2.99.18Transferred entry: 4.2.99.18.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XHI, chain A
Confidence level:very confident
Coverage over the Query: 4-165,187-259,330-403
View the alignment between query and template
View the model in PyMOL
Template: 1FN7, chain A
Confidence level:confident
Coverage over the Query: 10-165,187-321
View the alignment between query and template
View the model in PyMOL