Diaphorina citri psyllid: psy4744

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270
MEFNTGVARRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK
cccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHHHHcccccccccccccEEEEccccccHHHHcccccccccccccccHHHHHHcHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHcccccccccccccccccccccccccEEEEEEccHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHHHcccccccccEEEccccccc
*EFNTGVARRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFNTGVARRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0003674 [MF]molecular_functionprobable
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VZ8, chain A
Confidence level:very confident
Coverage over the Query: 2-270
View the alignment between query and template
View the model in PyMOL