Psyllid ID: psy4744

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270
MEFNTGVARRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK
cccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHHHHcccccccccccccEEEEccccccHHHHHccccccccccccccHHHHHHcHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHcccccccccccccccccccccccccEEEEEEccHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHHHcccccccccEEEccccccc
ccccHHHHccccccccccEEEccccccccHHcccHHHccccHHHHHHccHHHHHHHHHHHHHHHHccccHHHccccccEEEEEEccccHHHHccccccccEEEEcccHHHHHHccEEEEEcccccEEEEccccHHHHHHHHHHHHHHHcccccEEEEccEEEEcccHHHHHHHHHcccccccccccccccccccccccccEEEEEEEHHHHHHccccEEEEEEEccccccccccccccHHHHHHHHHHHHHccccHHHccEEEEcccccc
mefntgvarrncpikiksshntpasklqtITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILdaginpkslagsnssvytnscisddeslgcderlTTNFWLLAHVRCLLANRIAYLfdlkgpsftidnswtGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGlnrlspdgktrsfdhlangyarSEGIVVLLLQRSETALRSYGEVLHAesrfygslerpfvgfnQASLVEFFTNFYQkarvnpgqvdfleadgsaik
mefntgvarrncpikiksshntpasklqTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK
MEFNTGVARRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVsnlllnanlnslFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK
**************************LQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDF*********
MEFNTGVARRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSA**
********RRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK
*EFNTGVARRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEAD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFNTGVARRNCPIKIKSSHNTPASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query270 2.2.26 [Sep-21-2011]
P12785 2505 Fatty acid synthase OS=Ra yes N/A 0.914 0.098 0.358 2e-41
P12276 2512 Fatty acid synthase OS=Ga yes N/A 0.907 0.097 0.361 2e-41
P19096 2504 Fatty acid synthase OS=Mu yes N/A 0.911 0.098 0.369 2e-41
P36189352 Fatty acid synthase (Frag N/A N/A 0.907 0.696 0.345 9e-41
P49327 2511 Fatty acid synthase OS=Ho yes N/A 0.911 0.097 0.353 1e-39
Q71SP7 2513 Fatty acid synthase OS=Bo yes N/A 0.914 0.098 0.330 8e-39
Q4WAZ9 4007 Nonribosomal peptide synt yes N/A 0.666 0.044 0.344 1e-24
Q10977 1876 Phthiocerol synthesis pol no N/A 0.888 0.127 0.287 2e-24
Q7TXM0 1876 Phthiocerol/phenolphthioc no N/A 0.907 0.130 0.289 4e-24
Q54G30 2684 Probable polyketide synth yes N/A 0.866 0.087 0.294 9e-24
>sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 Back     alignment and function desciption
 Score =  169 bits (429), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 138/248 (55%), Gaps = 1/248 (0%)

Query: 24  ASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTN 83
           + KL+ ++KFD +FF +H + A+ +DP +R  +E  +EAI+D GINP SL G+N+ V+  
Sbjct: 51  SGKLKDLSKFDASFFGVHPKQAHTMDPQLRLLLEVSYEAIVDGGINPASLRGTNTGVWVG 110

Query: 84  SCISD-DESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQ 142
              S+  E+L  D      + ++   R ++ANR+++ FD KGPS  +D + +  +  L+ 
Sbjct: 111 VSGSEASEALSRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLLALQN 170

Query: 143 AVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVV 202
           A Q I  G    AIVG  NLLL  N +  F  L  LSPDG  RSFD   NGY R+E +V 
Sbjct: 171 AYQAIRSGECPAAIVGGINLLLKPNTSVQFMKLGMLSPDGTCRSFDDSGNGYCRAEAVVA 230

Query: 203 LLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFL 262
           +LL +   A R Y  +L+A +   G  E+     +  +  +   + YQ   V P  ++++
Sbjct: 231 VLLTKKSLARRVYATILNAGTNTDGCKEQGVTFPSGEAQEQLIRSLYQPGGVAPESLEYI 290

Query: 263 EADGSAIK 270
           EA G+  K
Sbjct: 291 EAHGTGTK 298
Fatty acid synthetase catalyzes the formation of long-chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. This multifunctional protein has 7 catalytic activities and an acyl carrier protein.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 1EC: 4
>sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 Back     alignment and function description
>sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 Back     alignment and function description
>sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 Back     alignment and function description
>sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 Back     alignment and function description
>sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 Back     alignment and function description
>sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 Back     alignment and function description
>sp|Q10977|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis GN=ppsA PE=3 SV=2 Back     alignment and function description
>sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 Back     alignment and function description
>sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query270
328703972 2090 PREDICTED: fatty acid synthase-like [Acy 0.922 0.119 0.533 2e-75
328722078 2202 PREDICTED: fatty acid synthase-like [Acy 0.907 0.111 0.420 4e-50
328703183 2215 PREDICTED: fatty acid synthase-like [Acy 0.903 0.110 0.408 4e-46
91078002 2153 PREDICTED: similar to p270 [Tribolium ca 0.877 0.110 0.369 5e-46
328703189 1899 PREDICTED: hypothetical protein LOC10056 0.966 0.137 0.376 2e-45
390359846 4047 PREDICTED: fatty acid synthase-like [Str 0.896 0.059 0.377 3e-44
112984340 2422 p270 [Bombyx mori] gi|2058460|gb|AAB5325 0.896 0.099 0.381 7e-44
357631736 2420 p270 [Danaus plexippus] 0.903 0.100 0.372 8e-44
350407733 2418 PREDICTED: fatty acid synthase-like [Bom 0.892 0.099 0.402 1e-43
242018452 2428 fatty acid synthase, putative [Pediculus 0.907 0.100 0.386 5e-43
>gi|328703972|ref|XP_001942950.2| PREDICTED: fatty acid synthase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 185/251 (73%), Gaps = 2/251 (0%)

Query: 22  TPAS--KLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSS 79
            PA+  K+    K D TF  ++SR+   LDPL RC +E  +EAI+DAG+NPK L GS +S
Sbjct: 54  VPAATGKISVHQKLDDTFMGMNSRIVKALDPLTRCLLERVYEAIIDAGLNPKHLYGSKTS 113

Query: 80  VYTNSCISDDESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEV 139
           VYT SC+SD E++GCDE+LTT FWLLAHVR LLANR++ +F+L+GPS+TID+SW GGIEV
Sbjct: 114 VYTASCVSDSEAIGCDEKLTTPFWLLAHVRALLANRVSNIFNLQGPSYTIDSSWIGGIEV 173

Query: 140 LRQAVQDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEG 199
           L+QA  D+++GR+ +A+VGV+N++ + ++   + GL++LS DG  RSFD  A+GY RSEG
Sbjct: 174 LKQAAADVAKGRIKSALVGVTNIIWHPDMAKHWIGLDKLSADGICRSFDENASGYGRSEG 233

Query: 200 IVVLLLQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQV 259
           +VVLLLQRS  ALRSYG +LH ++R        F+  ++ S  EFF +FY+  +V+P  V
Sbjct: 234 VVVLLLQRSTDALRSYGTILHCDARLCMEKAINFIRPSEDSFREFFKSFYEDCKVSPENV 293

Query: 260 DFLEADGSAIK 270
            +LE+DGSA K
Sbjct: 294 SYLESDGSACK 304

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328722078|ref|XP_001943289.2| PREDICTED: fatty acid synthase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328703183|ref|XP_001944653.2| PREDICTED: fatty acid synthase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91078002|ref|XP_969531.1| PREDICTED: similar to p270 [Tribolium castaneum] gi|270001419|gb|EEZ97866.1| hypothetical protein TcasGA2_TC000238 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328703189|ref|XP_003242120.1| PREDICTED: hypothetical protein LOC100569297, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|390359846|ref|XP_003729574.1| PREDICTED: fatty acid synthase-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|112984340|ref|NP_001037478.1| p270 [Bombyx mori] gi|2058460|gb|AAB53258.1| p270 [Bombyx mori] Back     alignment and taxonomy information
>gi|357631736|gb|EHJ79205.1| p270 [Danaus plexippus] Back     alignment and taxonomy information
>gi|350407733|ref|XP_003488176.1| PREDICTED: fatty acid synthase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242018452|ref|XP_002429689.1| fatty acid synthase, putative [Pediculus humanus corporis] gi|212514692|gb|EEB16951.1| fatty acid synthase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query270
FB|FBgn0027571 2544 CG3523 [Drosophila melanogaste 0.881 0.093 0.379 4e-38
WB|WBGene00009342 2613 fasn-1 [Caenorhabditis elegans 0.896 0.092 0.361 2.4e-35
UNIPROTKB|I3LC73 1375 FASN "Uncharacterized protein" 0.903 0.177 0.352 4.2e-35
MGI|MGI:95485 2504 Fasn "fatty acid synthase" [Mu 0.911 0.098 0.349 4.7e-35
RGD|620665 2505 Fasn "fatty acid synthase" [Ra 0.911 0.098 0.349 1.3e-34
UNIPROTKB|P12785 2505 Fasn "Fatty acid synthase" [Ra 0.911 0.098 0.349 1.3e-34
UNIPROTKB|F1N8A8 2512 FASN "Fatty acid synthase" [Ga 0.903 0.097 0.352 2.1e-34
UNIPROTKB|P12276 2512 FASN "Fatty acid synthase" [Ga 0.903 0.097 0.352 2.1e-34
UNIPROTKB|E1BW07 2513 FASN "Fatty acid synthase" [Ga 0.903 0.097 0.352 2.1e-34
UNIPROTKB|F1N647 2512 FASN "Fatty acid synthase" [Bo 0.911 0.097 0.337 4.3e-34
FB|FBgn0027571 CG3523 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 425 (154.7 bits), Expect = 4.0e-38, P = 4.0e-38
 Identities = 93/245 (37%), Positives = 133/245 (54%)

Query:    30 ITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISDD 89
             +  FDQ FF +H + A  +DPL+R  +E   EAI+DAG+NP  L GS + VY     S+ 
Sbjct:   201 LENFDQQFFGVHQKQAECMDPLLRMLLELTHEAIIDAGLNPSDLRGSRTGVYIGVSNSET 260

Query:    90 ESLGCDERLTTN-FWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDIS 148
             E   C +    N + L    R + ANRI++ FD KGPS++ID + +  +  L QA  D+ 
Sbjct:   261 EQHWCSDADRVNGYGLTGCARAMFANRISFTFDFKGPSYSIDTACSSSLYALEQAFSDMR 320

Query:   149 EGRVDTAIVGVXXXXXXXXXXXXFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRS 208
             EG+VD A+V              F+ LN LSPDG  ++FD   NGY RS+G VVLLLQR+
Sbjct:   321 EGKVDNALVAGAGLILKPTMSLQFKRLNMLSPDGSCKAFDESGNGYVRSDGCVVLLLQRT 380

Query:   209 ETALRSYGEVLHAESRFYGSLERPF---VGFNQASLVEFFTNFYQKARVNPGQVDFLEAD 265
               A R Y  +L+  +   G  E+     +G  Q  L+      Y++  +NP  V ++EA 
Sbjct:   381 SAARRVYASILNVRTNTDGFKEQGITYPIGKMQNRLIR---ETYEEIGLNPADVVYVEAH 437

Query:   266 GSAIK 270
             G+  K
Sbjct:   438 GTGTK 442
GO:0004312 "fatty acid synthase activity" evidence=ISS
GO:0016295 "myristoyl-[acyl-carrier-protein
GO:0009058 "biosynthetic process" evidence=IEA
GO:0004314 "[acyl-carrier-protein
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004313 "[acyl-carrier-protein
GO:0004316 "3-oxoacyl-[acyl-carrier-protein
GO:0016296 "palmitoyl-[acyl-carrier-protein
GO:0004320 "oleoyl-[acyl-carrier-protein
GO:0004317 "3-hydroxypalmitoyl-[acyl-carrier-protein
GO:0004319 "enoyl-[acyl-carrier-protein
GO:0004315 "3-oxoacyl-[acyl-carrier-protein
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
WB|WBGene00009342 fasn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I3LC73 FASN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:95485 Fasn "fatty acid synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620665 Fasn "fatty acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P12785 Fasn "Fatty acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8A8 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P12276 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW07 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N647 FASN "Fatty acid synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
cd00833 421 cd00833, PKS, polyketide synthases (PKSs) polymeri 1e-49
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and 8e-38
pfam00109243 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, 8e-35
smart00825298 smart00825, PKS_KS, Beta-ketoacyl synthase 2e-30
cd00825332 cd00825, decarbox_cond_enzymes, decarboxylating co 2e-14
cd00828407 cd00828, elong_cond_enzymes, "elongating" condensi 5e-08
COG0304 412 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) sy 5e-06
cd00834406 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier prot 2e-05
TIGR02813 2582 TIGR02813, omega_3_PfaA, polyketide-type polyunsat 5e-04
cd00832399 cd00832, CLF, Chain-length factor (CLF) is a facto 7e-04
cd00327254 cd00327, cond_enzymes, Condensing enzymes; Family 7e-04
>gnl|CDD|238429 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information 
 Score =  168 bits (427), Expect = 1e-49
 Identities = 85/245 (34%), Positives = 125/245 (51%), Gaps = 12/245 (4%)

Query: 30  ITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISD- 88
           +  FD  FF +  R A  +DP  R  +E  +EA+ DAG +P+SLAGS + V+  +  SD 
Sbjct: 66  VDAFDAAFFGISPREAEAMDPQQRLLLEVAWEALEDAGYSPESLAGSRTGVFVGASSSDY 125

Query: 89  DESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDIS 148
            E L  D      +      R  LANRI+Y FDL+GPS T+D + +  +  L  A Q + 
Sbjct: 126 LELLARDPDEIDAYAATGTSRAFLANRISYFFDLRGPSLTVDTACSSSLVALHLACQSLR 185

Query: 149 EGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRS 208
            G  D A+VG  NL+L+ ++   F     LSPDG+ R FD  A+GY R EG+ V++L+R 
Sbjct: 186 SGECDLALVGGVNLILSPDMFVGFSKAGMLSPDGRCRPFDADADGYVRGEGVGVVVLKRL 245

Query: 209 ETALRS----YGEVLHAESRFYG---SLERPFVGFNQASLVEFFTNFYQKARVNPGQVDF 261
             ALR     Y  +  +     G    +  P    +  +        Y +A V+P  +D+
Sbjct: 246 SDALRDGDRIYAVIRGSAVNQDGRTKGITAP----SGEAQAALIRRAYARAGVDPSDIDY 301

Query: 262 LEADG 266
           +EA G
Sbjct: 302 VEAHG 306

PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits. Length = 421
>gnl|CDD|225858 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215723 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>gnl|CDD|214836 smart00825, PKS_KS, Beta-ketoacyl synthase Back     alignment and domain information
>gnl|CDD|238421 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|238424 cd00828, elong_cond_enzymes, "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>gnl|CDD|223381 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|238430 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|238428 cd00832, CLF, Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 270
KOG1394|consensus 440 100.0
COG3321 1061 Polyketide synthase modules and related proteins [ 100.0
PRK08722 414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PLN02787 540 3-oxoacyl-[acyl-carrier-protein] synthase II 100.0
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 100.0
cd00832399 CLF Chain-length factor (CLF) is a factor required 100.0
PRK06333 424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
COG0304 412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 100.0
PRK09116405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK08439 406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK07967 406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 100.0
PRK07314 411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK07910 418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PTZ00050 421 3-oxoacyl-acyl carrier protein synthase; Provision 100.0
TIGR03150 407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 100.0
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK07103410 polyketide beta-ketoacyl:acyl carrier protein synt 100.0
PLN02836 437 3-oxoacyl-[acyl-carrier-protein] synthase 100.0
cd00828 407 elong_cond_enzymes "elongating" condensing enzymes 100.0
smart00825 424 PKS_KS Beta-ketoacyl synthase. The structure of be 100.0
cd00833 421 PKS polyketide synthases (PKSs) polymerize simple 100.0
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 100.0
PRK14691 342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 100.0
PRK05952381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
KOG1202|consensus 2376 100.0
PRK06501 425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK09185 392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 100.0
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 100.0
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 99.97
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 99.96
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 99.92
PRK06064389 acetyl-CoA acetyltransferase; Provisional 99.87
PRK05656393 acetyl-CoA acetyltransferase; Provisional 99.84
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 99.84
PRK07108392 acetyl-CoA acetyltransferase; Provisional 99.83
PRK12578385 acetyl-CoA acetyltransferase; Provisional 99.83
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.83
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 99.83
PRK06633392 acetyl-CoA acetyltransferase; Provisional 99.82
cd00829375 SCP-x_thiolase Thiolase domain associated with ste 99.81
PRK09051394 beta-ketothiolase; Provisional 99.81
PRK09052399 acetyl-CoA acetyltransferase; Provisional 99.81
PRK07661391 acetyl-CoA acetyltransferase; Provisional 99.81
PLN02287452 3-ketoacyl-CoA thiolase 99.8
PRK07516389 acetyl-CoA acetyltransferase; Provisional 99.8
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.8
PRK08131401 acetyl-CoA acetyltransferase; Provisional 99.8
TIGR01930386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 99.8
PRK05790393 putative acyltransferase; Provisional 99.79
PRK08256391 lipid-transfer protein; Provisional 99.79
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 99.79
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase. Members of this 99.79
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.79
PRK06205404 acetyl-CoA acetyltransferase; Provisional 99.79
PRK07851406 acetyl-CoA acetyltransferase; Provisional 99.78
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.78
PRK08963428 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.78
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.77
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 99.77
PRK07850387 acetyl-CoA acetyltransferase; Provisional 99.77
PRK08170426 acetyl-CoA acetyltransferase; Provisional 99.77
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.77
PRK06816 378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.77
TIGR02445385 fadA fatty oxidation complex, beta subunit FadA. T 99.77
PRK08313386 acetyl-CoA acetyltransferase; Provisional 99.76
PRK06157398 acetyl-CoA acetyltransferase; Validated 99.76
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.76
PRK06158384 thiolase; Provisional 99.76
PLN02644394 acetyl-CoA C-acetyltransferase 99.76
PRK06366388 acetyl-CoA acetyltransferase; Provisional 99.76
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.75
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 99.75
PRK06065392 acetyl-CoA acetyltransferase; Provisional 99.75
PRK06365 430 acetyl-CoA acetyltransferase; Provisional 99.75
PTZ00455438 3-ketoacyl-CoA thiolase; Provisional 99.75
PRK06289403 acetyl-CoA acetyltransferase; Provisional 99.75
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 99.74
TIGR02446 430 FadI fatty oxidation complex, beta subunit FadI. T 99.74
PRK06059399 lipid-transfer protein; Provisional 99.74
PRK08142 388 acetyl-CoA acetyltransferase; Provisional 99.73
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.73
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.71
cd00826393 nondecarbox_cond_enzymes nondecarboxylating conden 99.71
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.71
PRK06025417 acetyl-CoA acetyltransferase; Provisional 99.7
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.7
PRK09268 427 acetyl-CoA acetyltransferase; Provisional 99.69
PRK06690361 acetyl-CoA acetyltransferase; Provisional 99.68
PRK07855386 lipid-transfer protein; Provisional 99.68
TIGR02845327 spore_V_AD stage V sporulation protein AD. Bacillu 99.67
PRK06066385 acetyl-CoA acetyltransferase; Provisional 99.66
KOG1406|consensus 408 99.66
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 99.65
KOG1390|consensus396 99.65
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 99.65
cd00827324 init_cond_enzymes "initiating" condensing enzymes 99.62
PRK08257 498 acetyl-CoA acetyltransferase; Validated 99.6
TIGR00748 345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 99.59
PRK08304337 stage V sporulation protein AD; Validated 99.58
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.58
PRK04262 347 hypothetical protein; Provisional 99.56
PRK06840339 hypothetical protein; Validated 99.56
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.56
PRK07937352 lipid-transfer protein; Provisional 99.5
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 99.5
PLN03171 399 chalcone synthase-like protein; Provisional 99.49
PLN03172393 chalcone synthase family protein; Provisional 99.47
PRK12404334 stage V sporulation protein AD; Provisional 99.47
KOG1391|consensus396 99.46
PLN03170401 chalcone synthase; Provisional 99.45
PLN03169391 chalcone synthase family protein; Provisional 99.45
PLN03173391 chalcone synthase; Provisional 99.45
PLN03168389 chalcone synthase; Provisional 99.43
TIGR01835 379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 99.37
KOG1389|consensus435 99.33
PLN02854 521 3-ketoacyl-CoA synthase 99.32
PLN02577 459 hydroxymethylglutaryl-CoA synthase 99.27
PLN02932 478 3-ketoacyl-CoA synthase 99.22
PF00108264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 99.18
PLN02377 502 3-ketoacyl-CoA synthase 99.14
COG3425 377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 99.14
PLN02192 511 3-ketoacyl-CoA synthase 99.1
TIGR01833 454 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth 99.04
COG0183 392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 98.98
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 98.91
PF13723218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 98.9
KOG1392|consensus 465 98.86
PLN00415 466 3-ketoacyl-CoA synthase 98.77
PF08392290 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- 98.69
PF07451329 SpoVAD: Stage V sporulation protein AD (SpoVAD); I 98.65
PF00195226 Chal_sti_synt_N: Chalcone and stilbene synthases, 98.53
PF0854580 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) 98.51
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secon 98.41
PF01154174 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s 98.12
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 95.63
KOG1393|consensus 462 91.6
PRK05963 326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 81.61
>KOG1394|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.2e-53  Score=350.69  Aligned_cols=267  Identities=19%  Similarity=0.249  Sum_probs=243.9

Q ss_pred             hhhhhhhcCCCcccccCCCCCC---CCCCCCCCCCCcccCCCCHHHHhhcChHHHHHHHHHHHHHHHCCCCCC---CCCC
Q psy4744           2 EFNTGVARRNCPIKIKSSHNTP---ASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPK---SLAG   75 (270)
Q Consensus         2 ~~w~~l~~g~~~~~~~~~~~~~---~~~~~~~~~fd~~~~~~~~~~~~~~~~~~~l~l~a~~~Al~dAg~~~~---~~~~   75 (270)
                      ++|+.|.+|+++|+.+..++.+   ....+.++.|+.+.| +++...++|++..+|++.|+.+||+|+++.+.   ..+.
T Consensus        43 ~~w~~Ll~GesGI~~l~~~d~k~~p~~v~g~Ip~f~~e~~-~s~~~~r~ms~~~~~al~aa~eAL~da~~~~~~~~e~dk  121 (440)
T KOG1394|consen   43 TSWRNLLSGESGISSLEGPDYKSIPFTVAGKIPRFSVEDY-VSKGDERRMSKFTKLALTAAEEALKDAGLLDVNLSEEDK  121 (440)
T ss_pred             HHHHHhhccccCcccccccccccCcchheeeccccccccc-cchhhhhhhhHHHHHHHHHHHHHHHhcCCCCcccchhhh
Confidence            6899999999999988865554   367788889999987 99999999999999999999999999998654   3456


Q ss_pred             CCeEEEEccCCCCccc--------cccCccccchhhHhhhhhhhHHHHHHHHcCCCCCCccccccchhHHHHHHHHHHHH
Q psy4744          76 SNSSVYTNSCISDDES--------LGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDI  147 (270)
Q Consensus        76 ~~~gv~~g~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~a~~ia~~~gl~Gp~~~v~~~cas~~~al~~A~~~i  147 (270)
                      .++||.+|+++++...        .+...+.++|++.+..+.|+.+++++..||++||+.+++++|++|..+|..|.+.|
T Consensus       122 ~~~GV~iGtgmg~l~~i~e~a~~~~~~g~rrvsPffVPkil~NM~ag~vsm~~gl~GpnhsvSTACATg~h~igda~n~I  201 (440)
T KOG1394|consen  122 EKTGVLIGTGMGDLEDIYETAQNLSEKGYRRVSPFFVPKILTNMAAGYVSMKYGLRGPNHSVSTACATGNHCIGDAFNFI  201 (440)
T ss_pred             hhhceEeccccccHHHHHHHHHHHHHhcccccCccccchhhcccccchhhhhhcCcCCchhhHhhhhhccchHHHHHHHH
Confidence            7899999999998544        34467899999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCEEEEeeeccccCchhHHhhhcCcccCC-----CCCCcccCCCCCceeecCeeEEEEecChHHHHhhcCceEeEE
Q psy4744         148 SEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSP-----DGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAE  222 (270)
Q Consensus       148 ~~G~~d~~lv~g~~~~~~~~~~~~~~~~~~ls~-----~~~~~pfd~~~~g~~~geGA~alvL~~~~~A~~~~g~~~~~~  222 (270)
                      +.|++|++|+||+|...+|..+.+|.+..+|+.     ...+||||.+|+||++|||++++|||++++|++| |+.++++
T Consensus       202 r~GdaDvmlAGgsE~~I~PlslaGF~r~RALSt~nd~P~~aSRPfD~~RdGFVmGEGagvlvlEelEHA~~R-gA~I~AE  280 (440)
T KOG1394|consen  202 RLGDADVMLAGGSEACINPLSLAGFSRARALSTRNDNPQKASRPFDKKRDGFVMGEGAGVLVLEELEHAKKR-GAPIYAE  280 (440)
T ss_pred             HhCccceeeccCcceeecchhhhhHHHHHHhhhcCCCccccCCCCccCCCceeeccceeEEehHhHHHHHHc-CCceeHH
Confidence            999999999999999999999999999999984     4479999999999999999999999999999999 9999999


Q ss_pred             EeccCCCCCCC--c--CCCHHHHHHHHHHHHHHcCCCCCCccEEEcccCCCC
Q psy4744         223 SRFYGSLERPF--V--GFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK  270 (270)
Q Consensus       223 ~~~~~~~~~~~--~--~~~~~~~~~a~~~al~~agi~~~did~v~~hgtgt~  270 (270)
                      +.|+|.+++..  +  .|+..+...||++||++||+.|+|||||++|+|+||
T Consensus       281 ~lGygls~Da~HiT~P~~dG~Ga~~am~raL~~Agl~pe~i~YvNAHATST~  332 (440)
T KOG1394|consen  281 VLGYGLSSDAYHITSPDPDGAGAVLAMERALKDAGLSPEDIDYVNAHATSTP  332 (440)
T ss_pred             hhcCcccccccccCCCCCCcchHHHHHHHHHHHcCCChhhcCeeecccccCc
Confidence            99999887775  3  346677899999999999999999999999999997

>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1406|consensus Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>KOG1390|consensus Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>KOG1391|consensus Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>KOG1389|consensus Back     alignment and domain information
>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>KOG1392|consensus Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species Back     alignment and domain information
>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>KOG1393|consensus Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 1e-38
3hhd_A 965 Structure Of The Human Fatty Acid Synthase Ks-Mat D 7e-38
2qo3_A 915 Crystal Structure Of [ks3][at3] Didomain From Modul 6e-18
2hg4_A 917 Structure Of The Ketosynthase-acyltransferase Didom 2e-16
1tqy_A 424 The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Le 2e-07
2gfv_A 427 Structure Of E. Coli Fabf (Kasii) C163q Mutant Leng 3e-05
2gfw_A 427 Structure Of Wild Type E. Coli Fabf (Kasii) Length 3e-05
2gfy_A 427 Structure Of E. Coli Fabf(K335a) Mutant With Covale 3e-05
3hnz_A 427 Structure Of E. Coli Fabf(C163a) In Complex With Pl 3e-05
1b3n_A 412 Beta-Ketoacyl Carrier Protein Synthase As A Drug Ta 4e-05
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure 
Iteration: 1

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/247 (35%), Positives = 133/247 (53%), Gaps = 3/247 (1%)
Query: 26  KLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSC 85
           KL+ +++FD +FF +HS+ AN +DP +R  +E  +EAI+D GINP SL G+++ V+    
Sbjct: 53  KLKDLSRFDASFFGVHSKQANTMDPQLRMLLEVTYEAIVDGGINPASLRGTSTGVWVGVS 112
Query: 86  ISD-DESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAV 144
            SD  E+L  D      + ++   R ++ANR+++ FD KGPS TID + +  +  L+ A 
Sbjct: 113 SSDASEALSRDPETLVGYSMIGCQRAMMANRLSFFFDFKGPSITIDTACSSSLLALQSAY 172
Query: 145 QDISEGRVDTAIVGVXXXXXXXXXXXXFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLL 204
           Q I  G    A+VG             F  L  LS DG  RSFD    GY R+E +V +L
Sbjct: 173 QAIRGGECSAAVVGGLNVLLKPNSSLQFMKLGMLSQDGTCRSFDAEGTGYCRAEAVVAVL 232
Query: 205 LQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVE-FFTNFYQKARVNPGQVDFLE 263
           L +   A R Y  +L+A +   GS E+  V F    + E    + Y  A  +P  ++++E
Sbjct: 233 LTKKSLARRVYATILNAGTNTDGSKEQ-GVTFPSGDVQEQLIRSLYAPAGPDPESLEYIE 291
Query: 264 ADGSAIK 270
           A G+  K
Sbjct: 292 AHGTGTK 298
>pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat Didomain As A Framework For Inhibitor Design. Length = 965 Back     alignment and structure
>pdb|2QO3|A Chain A, Crystal Structure Of [ks3][at3] Didomain From Module 3 Of 6- Deoxyerthronolide B Synthase Length = 915 Back     alignment and structure
>pdb|2HG4|A Chain A, Structure Of The Ketosynthase-acyltransferase Didomain Of Module 5 From Debs. Length = 917 Back     alignment and structure
>pdb|1TQY|A Chain A, The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Length = 424 Back     alignment and structure
>pdb|2GFV|A Chain A, Structure Of E. Coli Fabf (Kasii) C163q Mutant Length = 427 Back     alignment and structure
>pdb|2GFW|A Chain A, Structure Of Wild Type E. Coli Fabf (Kasii) Length = 427 Back     alignment and structure
>pdb|2GFY|A Chain A, Structure Of E. Coli Fabf(K335a) Mutant With Covalently Linked Dodecanoic Acid Length = 427 Back     alignment and structure
>pdb|3HNZ|A Chain A, Structure Of E. Coli Fabf(C163a) In Complex With Platensimycin Length = 427 Back     alignment and structure
>pdb|1B3N|A Chain A, Beta-Ketoacyl Carrier Protein Synthase As A Drug Target, Implications From The Crystal Structure Of A Complex With The Inhibitor Cerulenin. Length = 412 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 6e-52
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 2e-40
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 1e-27
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 3e-27
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
 Score =  181 bits (460), Expect = 6e-52
 Identities = 87/243 (35%), Positives = 136/243 (55%), Gaps = 1/243 (0%)

Query: 26  KLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSC 85
           KL+ +++FD +FF +HS+ AN +DP +R  +E  +EAI+D GINP SL G+++ V+    
Sbjct: 53  KLKDLSRFDASFFGVHSKQANTMDPQLRMLLEVTYEAIVDGGINPASLRGTSTGVWVGVS 112

Query: 86  ISD-DESLGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAV 144
            SD  E+L  D      + ++   R ++ANR+++ FD KGPS TID + +  +  L+ A 
Sbjct: 113 SSDASEALSRDPETLVGYSMIGCQRAMMANRLSFFFDFKGPSITIDTACSSSLLALQSAY 172

Query: 145 QDISEGRVDTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLL 204
           Q I  G    A+VG  N+LL  N +  F  L  LS DG  RSFD    GY R+E +V +L
Sbjct: 173 QAIRGGECSAAVVGGLNVLLKPNSSLQFMKLGMLSQDGTCRSFDAEGTGYCRAEAVVAVL 232

Query: 205 LQRSETALRSYGEVLHAESRFYGSLERPFVGFNQASLVEFFTNFYQKARVNPGQVDFLEA 264
           L +   A R Y  +L+A +   GS E+     +     +   + Y  A  +P  ++++EA
Sbjct: 233 LTKKSLARRVYATILNAGTNTDGSKEQGVTFPSGDVQEQLIRSLYAPAGPDPESLEYIEA 292

Query: 265 DGS 267
            G+
Sbjct: 293 HGT 295
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Length = 915 Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Length = 917 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query270
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 100.0
4ewg_A 412 Beta-ketoacyl synthase; ssgcid, structural genomic 100.0
3ho9_A 427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 100.0
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 100.0
3o04_A 413 LMO2201 protein, beta-keto-acyl carrier protein sy 100.0
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 100.0
1e5m_A 416 KAS II, beta ketoacyl acyl carrier protein synthas 100.0
1tqy_A 424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 100.0
1tqy_B 415 Actinorhodin polyketide putative beta-ketoacyl SY; 100.0
2gqd_A 437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 100.0
2iwz_A 438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 100.0
1ox0_A 430 Beta ketoacyl-acyl carrier protein synthase; trans 100.0
2vba_A 406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 100.0
3kzu_A 428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 100.0
1j3n_A 408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 100.0
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 100.0
2gp6_A 434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 100.0
3mqd_A 428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 100.0
4ddo_A 451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 100.0
2ix4_A 431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 100.0
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 100.0
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 100.0
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 100.0
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 100.0
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 99.96
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 99.96
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 99.96
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 99.95
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 99.95
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 99.94
2wu9_A442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 99.94
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 99.94
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 99.94
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 99.93
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.93
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 99.93
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 99.93
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 99.93
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 99.92
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 99.92
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 99.92
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 99.91
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 99.9
1u0m_A382 Putative polyketide synthase; type III polyketide 99.89
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 99.89
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 99.89
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 99.86
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 99.85
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.85
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 99.84
4egv_A 520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 99.82
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.79
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 99.78
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 99.76
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 99.75
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 99.75
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 99.74
3a5r_A387 Benzalacetone synthase; chalcone synthase, type II 99.74
1xpm_A 396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 99.73
1i88_A389 CHS2, chalcone synthase 2; polyketide synthase, tr 99.72
3lma_A 347 Stage V sporulation protein AD (spovad); NESG, str 99.71
2f82_A 450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 99.7
1ee0_A402 2-pyrone synthase; polyketide synthase, thiolase f 99.7
3awk_A402 Chalcone synthase-like polyketide synthase; type I 99.69
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 99.69
1xes_A413 Dihydropinosylvin synthase; native structure, tran 99.68
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 99.66
2p0u_A413 Stilbenecarboxylate synthase 2; polyketide synthas 99.66
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.64
3oit_A 387 OS07G0271500 protein; type III polyketide synthase 99.62
3ov2_A393 Curcumin synthase; type III polyketide synthase, t 99.62
3euo_A379 Type III pentaketide synthase; alpha helix, acyltr 99.6
3e1h_A 465 PKSIIINC, putative uncharacterized protein; resorc 99.58
3v7i_A413 Putative polyketide synthase; type III polyketide 99.58
3v4n_A 388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 99.56
2v4w_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 99.54
3sqz_A 425 Putative hydroxymethylglutaryl-COA synthase; thiol 99.54
2p8u_A 478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 99.4
2wya_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 99.22
3lma_A 347 Stage V sporulation protein AD (spovad); NESG, str 83.02
4ewp_A 350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 82.43
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
Probab=100.00  E-value=3.3e-52  Score=402.29  Aligned_cols=269  Identities=32%  Similarity=0.566  Sum_probs=246.6

Q ss_pred             hhhhhhhcCCCcccccCCCCC------C--CCCCCCCCCCCcccCCCCHHHHhhcChHHHHHHHHHHHHHHHCCCCCCCC
Q psy4744           2 EFNTGVARRNCPIKIKSSHNT------P--ASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSL   73 (270)
Q Consensus         2 ~~w~~l~~g~~~~~~~~~~~~------~--~~~~~~~~~fd~~~~~~~~~~~~~~~~~~~l~l~a~~~Al~dAg~~~~~~   73 (270)
                      +||+.|.+|++.++..+....      +  .+++.+++.||+.+|++++++++.|||+++|+++++++||+|||++++++
T Consensus        23 ~~W~~l~~g~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~FD~~~f~i~~~ea~~mDp~~rL~leaa~eALedAGi~~~~i  102 (965)
T 3hhd_A           23 EFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSL  102 (965)
T ss_dssp             HHHHHHHTTCCCEECSSSSSCTTGGGCCSCEECCSCSSCCCTTTTTCCHHHHHTSCHHHHHHHHHHHHHHHHTTCCGGGG
T ss_pred             HHHHHHHcCCCcccCCCcccccccccCcccccccCChhhcChhhcCCCHHHHhhcCHHHHHHHHHHHHHHHHcCCChHHc
Confidence            799999999999987543111      1  15667888899999999999999999999999999999999999999999


Q ss_pred             CCCCeEEEEccCCCCccc-cccCccccchhhHhhhhhhhHHHHHHHHcCCCCCCccccccchhHHHHHHHHHHHHhcCCC
Q psy4744          74 AGSNSSVYTNSCISDDES-LGCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRV  152 (270)
Q Consensus        74 ~~~~~gv~~g~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~a~~ia~~~gl~Gp~~~v~~~cas~~~al~~A~~~i~~G~~  152 (270)
                      ++.++||++|+...++.. .......+.++...+...+.++++|++.||++||+++|+++|+|++.||.+|+++|++|+|
T Consensus       103 ~~~~~Gv~vG~~~~d~~~~~~~~~~~~~~~~~~g~~~~~~a~ris~~lgl~GPs~tvdtACSSsl~Al~~A~~~I~~G~~  182 (965)
T 3hhd_A          103 RGTHTGVWVGVSGSETSEALSRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC  182 (965)
T ss_dssp             TTSCCEEEEEECCCHHHHHHTSCTTTCCTHHHHHHSTTHHHHHHHHHHTCCSCEEEEECGGGHHHHHHHHHHHHHHTTSC
T ss_pred             CCceeEEEEeccchhHHHHHhcCccccCcccccccccchHHHHHHHHhCCCCCeeeecCchHHHHHHHHHHHHHHHcCCC
Confidence            999999999998887654 4445566778888999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEeeeccccCchhHHhhhcCcccCCCCCCcccCCCCCceeecCeeEEEEecChHHHHhhcCceEeEEEeccCCCCCC
Q psy4744         153 DTAIVGVSNLLLNANLNSLFQGLNRLSPDGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYGEVLHAESRFYGSLERP  232 (270)
Q Consensus       153 d~~lv~g~~~~~~~~~~~~~~~~~~ls~~~~~~pfd~~~~g~~~geGA~alvL~~~~~A~~~~g~~~~~~~~~~~~~~~~  232 (270)
                      |++||||+|.++++..+..|..++.+++++.|+|||.+++|+++|||++++||+++++|+++++.+.+..++.++....+
T Consensus       183 d~aLagGv~~~~~p~~~~~~~~~~~ls~~g~~~~Fd~~adG~~~gEGagavvL~~l~~A~~i~a~I~g~~~n~dg~~~~~  262 (965)
T 3hhd_A          183 PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLARRVYATILNAGTNTDGFKEQG  262 (965)
T ss_dssp             SEEEEEEEECCCCHHHHHHHHHHTCBCTTCCCCTTBTTCCSBCBBCEEEEEEEEEGGGCSSCSEEEEEEEEEECCCCTTC
T ss_pred             CEEEEeeeccccCHHHHHHHHhccCcCCCCccccchhccCCccccceEEEEEEecHHHcCcccEEEEeeeccCCCCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999887788888888888866567


Q ss_pred             CcCCCHHHHHHHHHHHHHHcCCCCCCccEEEcccCCCC
Q psy4744         233 FVGFNQASLVEFFTNFYQKARVNPGQVDFLEADGSAIK  270 (270)
Q Consensus       233 ~~~~~~~~~~~a~~~al~~agi~~~did~v~~hgtgt~  270 (270)
                      .+.|+..++.++|+++|++||++|+||||||+|||||+
T Consensus       263 ~t~P~~~~q~~~i~~Al~~Agl~p~dIdyvEaHgTgT~  300 (965)
T 3hhd_A          263 VTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTK  300 (965)
T ss_dssp             TTSCCHHHHHHHHHHHHHHTTCCGGGEEEEECCCCCCT
T ss_pred             CcCCCHHHHHHHHHHHHHHhCCCHHHhccccccCCCCC
Confidence            78999999999999999999999999999999999996
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 270
d1j3na1249 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II { 7e-30
d2gfva1250 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II { 8e-27
d1ox0a1256 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II 6e-25
d1e5ma1250 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II { 1e-22
d2ix4a1270 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II 1e-16
d2vbaa1253 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {E 1e-11
d1tqya2 205 c.95.1.1 (A:219-423) Actinorhodin polyketide putat 2e-08
d1tqya1216 c.95.1.1 (A:3-218) Actinorhodin polyketide putativ 3e-08
d1tqyb2 194 c.95.1.1 (B:210-403) Actinorhodin polyketide putat 5e-08
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 249 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Beta-ketoacyl-ACP synthase II
species: Thermus thermophilus [TaxId: 274]

 Score =  110 bits (276), Expect = 7e-30
 Identities = 39/179 (21%), Positives = 68/179 (37%), Gaps = 13/179 (7%)

Query: 48  LDPLVRCFIEPCFEAILDAGINPKSLAGSNSSVYTNSCISD--------DESLGCDERLT 99
           LD  V+  +     A+ DAG+ P+ L          + I             L       
Sbjct: 68  LDRFVQYALIAAQLALEDAGLKPEDLDPERVGTLVGTGIGGMETWEAQSRVFLERGPNRI 127

Query: 100 TNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEGRVDTAIVGV 159
           + F++   +  + +  IA  +   GPS T+  +   G + L  A++ I  G  D  + G 
Sbjct: 128 SPFFIPMMIANMASAHIAMRYGFTGPSSTVVTACATGADALGSALRMIQLGEADLVLAGG 187

Query: 160 SNLLLNANLNSLFQGLNRLS-----PDGKTRSFDHLANGYARSEGIVVLLLQRSETALR 213
           +   +       F  +  LS     P+  +R F    +G+   EG  VL+L+  E A +
Sbjct: 188 TEAAITPMAIGAFAVMRALSTRNEEPEKASRPFTLSRDGFVMGEGAGVLVLEAYEHAKK 246
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 256 Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 250 Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 270 Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 205 Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 216 Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query270
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 100.0
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 100.0
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 100.0
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 100.0
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 100.0
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 100.0
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 99.97
d1tqya1216 Actinorhodin polyketide putative beta-ketoacyl syn 99.97
d1tqya2 205 Actinorhodin polyketide putative beta-ketoacyl syn 99.83
d1tqyb2 194 Actinorhodin polyketide putative beta-ketoacyl syn 99.82
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 99.49
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 99.46
d1m3ka1268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 99.46
d1ulqa1273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 99.46
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 99.46
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 99.42
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 99.41
d1wdkc1262 Fatty oxidation complex beta subunit (3-ketoacyl-C 99.37
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 99.32
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 99.29
d1afwa1269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 99.28
d1e5ma2 161 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 99.0
d1xpma1166 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 98.96
d2gfva2 161 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 98.94
d1j3na2 159 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 98.93
d1ox0a2 158 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 98.9
d2ix4a2 161 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 98.76
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 96.67
d1wdkc2128 Fatty oxidation complex beta subunit (3-ketoacyl-C 96.21
d1ulqa2125 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 95.88
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 95.31
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 92.45
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 91.89
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 90.43
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 90.16
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 89.35
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 86.51
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 85.58
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 84.52
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 81.22
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 80.99
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Beta-ketoacyl-ACP synthase II
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1e-42  Score=288.54  Aligned_cols=213  Identities=17%  Similarity=0.267  Sum_probs=190.3

Q ss_pred             hhhhhhhcCCCcccccCCCCCC---CCCCCCCCCCCcccCCCCHHHHhhcChHHHHHHHHHHHHHHHCCCCCCCCCCCCe
Q psy4744           2 EFNTGVARRNCPIKIKSSHNTP---ASKLQTITKFDQTFFSLHSRLANVLDPLVRCFIEPCFEAILDAGINPKSLAGSNS   78 (270)
Q Consensus         2 ~~w~~l~~g~~~~~~~~~~~~~---~~~~~~~~~fd~~~~~~~~~~~~~~~~~~~l~l~a~~~Al~dAg~~~~~~~~~~~   78 (270)
                      |||++|.+|++.|+..+.++..   ......++.|+...+ +++++.+.++|+++|++.++.+||+|||+..++++..++
T Consensus        21 ~~w~~L~~G~s~i~~~~~~~~~~~~~~~~~~v~~~~~~~~-~~~~~~~~~d~~~~~~l~aa~~Al~dAg~~~~~~~~~~~   99 (250)
T d2gfva1          21 STWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDI-ISRKEQRKMDAFIQYGIVAGVQAMQDSGLEITEENATRI   99 (250)
T ss_dssp             HHHHHHHTTCCCEEECCSSCCTTCSCCEEECCTTCCCTTT-SCHHHHTTSCHHHHHHHHHHHHHHHHHTCCCCTTTGGGE
T ss_pred             HHHHHHHcCCCeeecCCcccccccCCccceecccchhhhh-hhhHHHhhcCHHHHHHHHHHHHHHHhcCCCccccCccce
Confidence            7999999999999887654433   244556777887765 899999999999999999999999999999989899999


Q ss_pred             EEEEccCCCCcccc--------ccCccccchhhHhhhhhhhHHHHHHHHcCCCCCCccccccchhHHHHHHHHHHHHhcC
Q psy4744          79 SVYTNSCISDDESL--------GCDERLTTNFWLLAHVRCLLANRIAYLFDLKGPSFTIDNSWTGGIEVLRQAVQDISEG  150 (270)
Q Consensus        79 gv~~g~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~a~~ia~~~gl~Gp~~~v~~~cas~~~al~~A~~~i~~G  150 (270)
                      ||++|++.+.....        ......+.+..++..+.+.++.+|+..||++||+++|+++|+||+.||..|+++|++|
T Consensus       100 gv~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~ia~~~gl~Gp~~tv~~aCaSg~~Ai~~A~~~i~~G  179 (250)
T d2gfva1         100 GAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAQTSGVHNIGHAARIIAYG  179 (250)
T ss_dssp             EEEEECSSCCHHHHHHHHHHHHHHCGGGSCTTHHHHHSTTHHHHHHHHHTTCCSCEECCCCGGGHHHHHHHHHHHHHHHT
T ss_pred             EEEEeeccCCcchhhhhHHHHhhccccccccchhhhhhhhHHHHHHHHHhCCCCCccccccccchhhhhhHHHHHHHHcC
Confidence            99999988774332        2245567788899999999999999999999999999999999999999999999999


Q ss_pred             CCCEEEEeeeccccCchhHHhhhcCcccCC-----CCCCcccCCCCCceeecCeeEEEEecChHHHHhhcC
Q psy4744         151 RVDTAIVGVSNLLLNANLNSLFQGLNRLSP-----DGKTRSFDHLANGYARSEGIVVLLLQRSETALRSYG  216 (270)
Q Consensus       151 ~~d~~lv~g~~~~~~~~~~~~~~~~~~ls~-----~~~~~pfd~~~~g~~~geGA~alvL~~~~~A~~~~g  216 (270)
                      ++|++||||+|...+|..+..|..++.++.     ++.|||||++++|+++|||+++||||++++|++| |
T Consensus       180 ~~d~~lvgg~d~~~~~~~~~~f~~~~~ls~~~~~p~~~~rPFD~~rdG~v~gEGaa~lVLE~~~~A~~r-G  249 (250)
T d2gfva1         180 DADVMVAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKR-G  249 (250)
T ss_dssp             SCSEEEEEEEECCCSHHHHHHHHHTTCBCCCTTCHHHHCCTTBTTCCSBCBBCEEEEEEEEEHHHHHHH-T
T ss_pred             CcchhhcccchhhcCcHHHHHHHhcccccCCCCCCCCccCCCCCCCCCEeeeeEEEEEEECcHHHHHHC-c
Confidence            999999999999899999999999999984     3569999999999999999999999999999988 5
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure