Diaphorina citri psyllid: psy4746

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----

MLTNHEQHCLTSVNNWELSTCYQRWLTPFHYCSQIRDIIATATKGQTEYRKLMDETLDYLRRLNVPPRIRERVKQWFSFTWEQQHTLGYWYISWLCLVTLSYLYNCFVIPLRVTFPYQTRSNLITWFVFDYVMDVIYILDLLLIKPRLIYLDDGFWIKDSKLTRIQYRRKLQYKNDLLSLMPFDLLYFVFGFECTFLRLPRLIKIQTFWEFCNHFDSVLASPYVVRVARTLTYMIYLVHLNACAYYEISVREGLGINSWVYDGKGNAYIRCFYFATKTATSIGKNPRPTNEMEYVFMTVSWLLGVFVFAVLIGQ

cccccccHHcccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEcccCEECcHHHHHHHccccccHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHEEEEEcc

*******HCLTSVNNWELSTCYQRWLTPFHYCSQIR************************************VKQWFSFTWEQQHTLGYWYISWLCLVTLSYLYNCFVIPLRVTFPYQTRSNLITWFVFDYVMDVIYILDLLLIKPRLIYLDDGFWIKDSKLTRIQYRRKLQYKNDLLSLMPFDLLYFVFGFECTFLRLPRLIKIQTFWEFCNHFDSVLASPYVVRVARTLTYMIYLVHLNACAYYEISVREGLGINSWVYDGKGNAYIRCFYFATKTATSIGKNPRPTNEMEYVFMTVSWLLGVFVFAVLIGQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031513 [CC]	nonmotile primary cilium	probable	GO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0051290 [BP]	protein heterotetramerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051291, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0017071 [CC]	intracellular cyclic nucleotide activated cation channel complex	probable	GO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0005575, GO:0034702, GO:0034703, GO:0044425, GO:0031224
GO:0005223 [MF]	intracellular cGMP activated cation channel activity	probable	GO:0022891, GO:0008324, GO:0005261, GO:0043855, GO:0005221, GO:0005215, GO:0005216, GO:0005217, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022892, GO:0022834, GO:0022803, GO:0022839, GO:0022838
GO:0005222 [MF]	intracellular cAMP activated cation channel activity	probable	GO:0022891, GO:0008324, GO:0005261, GO:0043855, GO:0005221, GO:0005215, GO:0005216, GO:0005217, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022892, GO:0022834, GO:0022803, GO:0022839, GO:0022838
GO:0006873 [BP]	cellular ion homeostasis	probable	GO:0019725, GO:0050801, GO:0009987, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0030553 [MF]	cGMP binding	probable	GO:0043168, GO:0030551, GO:0019001, GO:0097159, GO:0000166, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:0043167, GO:1901363, GO:1901265, GO:0005488

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R9R, chain B
Confidence level:confident
Coverage over the Query: 80-152,163-313
View the alignment between query and template
View the model in PyMOL

Template: 3UKN, chain A
Confidence level:confident
Coverage over the Query: 46-82
View the alignment between query and template
View the model in PyMOL

Template: 3VOU, chain A
Confidence level:probable
Coverage over the Query: 10-66
View the alignment between query and template
View the model in PyMOL