Diaphorina citri psyllid: psy4754

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MGKNHCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRDEESKNRYMQYLLRSRITKPTQGLTVYFQDRGRSI
ccccEEEEEEccccEEEEEECcccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccCEEEEcccccccccccccccccEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEcccccCEEEEccccccccccEEcccccEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEccccCEEEEcccccccEEEEEEcccccCEEEEcccccEEEEEcccccccccccccccccccEEEEEEccccccc
MGKNHCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRDEESKNRYMQYLLRSRITKPTQGLTVYFQDRGRSI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKNHCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRCRLFDLRADKEVACYKKDSILFGATSVDFSVSGRLLFAGYNDYTINVWDSLKCCRVNHLMGHENRVSCLQVSPDGTAFSSGSWDTTLRDEESKNRYMQYLLRSRITKPTQGLTVYFQDRGRSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Guanine nucleotide-binding protein subunit beta-5 Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.confidentQ6PNB6
Guanine nucleotide-binding protein subunit beta-5 Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.confidentP62882
Guanine nucleotide-binding protein subunit beta-5 Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.confidentQ5RDY7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005834 [CC]heterotrimeric G-protein complexprobableGO:0043234, GO:0019897, GO:0032991, GO:0016020, GO:0044464, GO:0009898, GO:0019898, GO:0005575, GO:0071944, GO:0005623, GO:0005886, GO:0044424, GO:0044425, GO:0005622, GO:0044459, GO:0031234
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032092 [BP]positive regulation of protein bindingprobableGO:0051099, GO:0051098, GO:0008150, GO:0065007, GO:0044093, GO:0043393, GO:0065009
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0030159 [MF]receptor signaling complex scaffold activityprobableGO:0005488, GO:0003674, GO:0032947, GO:0005515, GO:0005198
GO:0006112 [BP]energy reserve metabolic processprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0010619 [BP]adenylate cyclase-activating glucose-activated G-protein coupled receptor signaling pathwayprobableGO:0070887, GO:0071310, GO:0042592, GO:0042593, GO:0023052, GO:0007165, GO:0007166, GO:0042221, GO:0009749, GO:0050789, GO:0044699, GO:0009757, GO:0009756, GO:0033500, GO:0010255, GO:0007188, GO:0007189, GO:0010182, GO:0071331, GO:0071333, GO:0065007, GO:0065008, GO:0007186, GO:0007187, GO:0019725, GO:1901700, GO:1901701, GO:0009987, GO:0051716, GO:0050794, GO:0044763, GO:0001678, GO:0007154, GO:0055082, GO:0010033, GO:0009746, GO:0044700, GO:0009743, GO:0034284, GO:0071322, GO:0050896, GO:0071326, GO:0048878, GO:0008150
GO:0001917 [CC]photoreceptor inner segmentprobableGO:0005575, GO:0044464, GO:0005623
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007191 [BP]adenylate cyclase-activating dopamine receptor signaling pathwayprobableGO:0065007, GO:0044700, GO:0051716, GO:0008150, GO:0007212, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0007188, GO:0007189, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0007190 [BP]activation of adenylate cyclase activityprobableGO:0019220, GO:0031281, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0051339, GO:0045981, GO:0043085, GO:0009893, GO:0030819, GO:0030816, GO:0045761, GO:0045762, GO:0009891, GO:0030810, GO:0050789, GO:0065007, GO:0044093, GO:0051349, GO:0048518, GO:0065009, GO:0045935, GO:0045937, GO:0019219, GO:0050790, GO:0009889, GO:0050794, GO:0051174, GO:1900542, GO:0008150, GO:0051171, GO:0051173, GO:0030799, GO:0031279, GO:1900544, GO:1900371, GO:0030808, GO:0080090, GO:0030804, GO:0030801, GO:1900373, GO:0030802, GO:0030817, GO:0006140, GO:0030814, GO:0010562, GO:0048522
GO:0045014 [BP]negative regulation of transcription by glucoseprobableGO:0009991, GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0051716, GO:0010605, GO:0045013, GO:0031670, GO:0050896, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0046015, GO:0071496, GO:0045934, GO:0019219, GO:0007584, GO:0009987, GO:0009889, GO:0050794, GO:0045990, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0042221, GO:0019222, GO:0031668, GO:0031669, GO:0009605, GO:0051253, GO:0051252, GO:0031667, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0007200 [BP]phospholipase C-activating G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0050909 [BP]sensory perception of tasteprobableGO:0032501, GO:0044707, GO:0050877, GO:0007606, GO:0007600, GO:0008150, GO:0044699, GO:0003008
GO:0071377 [BP]cellular response to glucagon stimulusprobableGO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0033762, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0042622 [CC]photoreceptor outer segment membraneprobableGO:0060170, GO:0043229, GO:0071944, GO:0005929, GO:0043227, GO:0043226, GO:0044446, GO:0072372, GO:0031090, GO:0031514, GO:0016020, GO:0031513, GO:0044459, GO:0031253, GO:0005886, GO:0042995, GO:0001750, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044441, GO:0044424, GO:0044425, GO:0044422
GO:0010659 [BP]cardiac muscle cell apoptotic processprobableGO:0010259, GO:0009987, GO:0006915, GO:0008150, GO:0012501, GO:0044763, GO:0010658, GO:0010657, GO:0007569, GO:0097285, GO:0044699
GO:0071380 [BP]cellular response to prostaglandin E stimulusprobableGO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0071379, GO:0071310, GO:0034694, GO:0034695, GO:0071495, GO:0071398, GO:0009987, GO:0071396, GO:0032870, GO:0008150, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0070542, GO:0033993, GO:0044763, GO:0050896
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0019933 [BP]cAMP-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0019935, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0071456 [BP]cellular response to hypoxiaprobableGO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0031138 [BP]negative regulation of conjugation with cellular fusionprobableGO:0046999, GO:0031137, GO:0031135, GO:0050794, GO:0008150, GO:0043900, GO:0043901, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0051020 [MF]GTPase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0071870 [BP]cellular response to catecholamine stimulusprobableGO:0070887, GO:0071867, GO:0071868, GO:0071869, GO:0044699, GO:0009719, GO:0051716, GO:1901698, GO:0071417, GO:0071310, GO:0014070, GO:0071495, GO:0009987, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0050896, GO:1901699, GO:0008150, GO:0010243
GO:0005681 [CC]spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0010972 [BP]negative regulation of G2/M transition of mitotic cell cycleprobableGO:0045930, GO:0007346, GO:0045786, GO:0051726, GO:0008150, GO:0010564, GO:0050794, GO:0050789, GO:1901987, GO:0010948, GO:0065007, GO:1901991, GO:1901990, GO:0048519, GO:0048523, GO:0010389, GO:1901988

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 2-304
View the alignment between query and template
View the model in PyMOL
Template: 1K3I, chain A
Confidence level:probable
Coverage over the Query: 5-284
View the alignment between query and template
View the model in PyMOL