Diaphorina citri psyllid: psy4755


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MLGVIFKKQQRNPPKIRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITAPKRTLQDKTTERPVPIVQTGVPALKPQAPSSNSSTQQSQPIITSPTPSAP
cccccccccccccccEEccccEEEEEEcccccccccccEEEEEEccEEEEEEEEEEECccccCEEEEEEEEEEcccccccccEEEECccccEEEEECcccccccccccEEEEEEECccccccccccccccccccccccccccccccc
**G*****************ALTLPFCIPSFLGAPSHEISIKTVDGFILVEGK*********FISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITA**************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGVIFKKQQRNPPKIRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITAPKRTLQDKTTERPVPIVQTGVPALKPQAPSSNSSTQQSQPIITSPTPSAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein lethal(2)essential for life Vital role in embryonic development.confidentP82147
Alpha-crystallin B chain May contribute to the transparency and refractive index of the lens.confidentQ7M2W6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y1Y, chain A
Confidence level:very confident
Coverage over the Query: 20-100
View the alignment between query and template
View the model in PyMOL
Template: 2BOL, chain A
Confidence level:very confident
Coverage over the Query: 18-128
View the alignment between query and template
View the model in PyMOL