Psyllid ID: psy4755

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MLGVIFKKQQRNPPKIRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITAPKRTLQDKTTERPVPIVQTGVPALKPQAPSSNSSTQQSQPIITSPTPSAP
cccccccccccccccEEccccEEEEEEcccccccccccEEEEEEccEEEEEEEEEEEEccccEEEEEEEEEEEcccccccccEEEEEccccEEEEEEcccccccccccEEEEEEEEccccccccccccccccccccccccccccccc
cccEEEEcccccEEEEEccccEEEEEEccccccccccEEEEEEEccEEEEEEcccccccccccEEHHHEEEEEccccccHHHEEEEcccccEEEEEccccccccccccEEEEEEEcccccccccccccccccccccccccccccccc
MLGVIfkkqqrnppkirkpraltlpfcipsflgapsheisiKTVDGFILvegkheekedehgfisrqfkrryllpkdveIEKVTSslssdgvltitapkrtlqdktterpvpivqtgvpalkpqapssnsstqqsqpiitsptpsap
mlgvifkkqqrnppkirkpralTLPFCIPSFLGAPSHEISIKTVDGFILVEGKheekedehgfisrqfkrryllpKDVEIEKvtsslssdgvltitapkrtlqdktterpvpIVQTGVPALkpqapssnsstqqsqpiitsptpsap
MLGVIFKKQQRNPPKIRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVegkheekedehgFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITAPKRTLQDKTTERPVPIVQTGVPALKpqapssnsstqqsqpiitsptpsap
********************ALTLPFCIPSFLGAPSHEISIKTVDGFILVEGK*******HGFISRQFKRRYLLPKDVEIEKV*********L******************************************************
**G*******************TLPFCIPSFLGAPSHEISIKTVDGFILVEG**********FI*RQFKRRYLLPKDVEIEKVTSSLSSDGVLTITA**************************************************
MLGVIFKKQQRNPPKIRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGK*********FISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITAPKRTLQDKTTERPVPIVQTGVPA***************************
MLGVIFKKQQRNPPKIRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITAPKRTLQDKTTERPVPIVQTGV*****************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGVIFKKQQRNPPKIRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITAPKRTLQDKTTERPVPIVQTGVPALKPQAPSSNSSTQQSQPIITSPTPSAP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
P82147187 Protein lethal(2)essentia yes N/A 0.646 0.508 0.568 7e-23
P02516186 Heat shock protein 23 OS= no N/A 0.544 0.430 0.567 1e-18
P02517208 Heat shock protein 26 OS= no N/A 0.619 0.437 0.5 2e-18
P02504173 Alpha-crystallin A chain yes N/A 0.598 0.508 0.422 5e-17
Q7M2W6175 Alpha-crystallin B chain yes N/A 0.557 0.468 0.511 5e-17
P02505173 Alpha-crystallin A chain N/A N/A 0.598 0.508 0.422 6e-17
O13224201 Heat shock protein beta-1 N/A N/A 0.578 0.422 0.517 9e-17
P02510175 Alpha-crystallin B chain yes N/A 0.557 0.468 0.5 1e-16
Q9EPF3175 Alpha-crystallin B chain N/A N/A 0.557 0.468 0.5 1e-16
P23928175 Alpha-crystallin B chain yes N/A 0.557 0.468 0.5 1e-16
>sp|P82147|L2EFL_DROME Protein lethal(2)essential for life OS=Drosophila melanogaster GN=l(2)efl PE=1 SV=1 Back     alignment and function desciption
 Score =  105 bits (263), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 67/95 (70%)

Query: 38  EISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITA 97
           EI++K  D F++VEGKHEEK+DEHG++SRQF RRY LP DV  + VTSSLSSDG+LTI A
Sbjct: 92  EITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKA 151

Query: 98  PKRTLQDKTTERPVPIVQTGVPALKPQAPSSNSST 132
           P + L    TER V I QTG  + +  A    +ST
Sbjct: 152 PMKALPPPQTERLVQITQTGPSSKEDNAKKVETST 186
Vital role in embryonic development.
Drosophila melanogaster (taxid: 7227)
>sp|P02516|HSP23_DROME Heat shock protein 23 OS=Drosophila melanogaster GN=Hsp23 PE=2 SV=2 Back     alignment and function description
>sp|P02517|HSP26_DROME Heat shock protein 26 OS=Drosophila melanogaster GN=Hsp26 PE=1 SV=2 Back     alignment and function description
>sp|P02504|CRYAA_CHICK Alpha-crystallin A chain OS=Gallus gallus GN=CRYAA PE=1 SV=2 Back     alignment and function description
>sp|Q7M2W6|CRYAB_PIG Alpha-crystallin B chain OS=Sus scrofa GN=CRYAB PE=2 SV=1 Back     alignment and function description
>sp|P02505|CRYAA_RHEAM Alpha-crystallin A chain OS=Rhea americana GN=CRYAA PE=1 SV=1 Back     alignment and function description
>sp|O13224|HSPB1_POELU Heat shock protein beta-1 OS=Poeciliopsis lucida GN=hspb1 PE=2 SV=1 Back     alignment and function description
>sp|P02510|CRYAB_BOVIN Alpha-crystallin B chain OS=Bos taurus GN=CRYAB PE=1 SV=2 Back     alignment and function description
>sp|Q9EPF3|CRYAB_SPAJD Alpha-crystallin B chain OS=Spalax judaei GN=CRYAB PE=2 SV=1 Back     alignment and function description
>sp|P23928|CRYAB_RAT Alpha-crystallin B chain OS=Rattus norvegicus GN=Cryab PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
193688392197 PREDICTED: protein lethal(2)essential fo 0.666 0.497 0.631 8e-29
242015113189 protein lethal, putative [Pediculus huma 0.707 0.550 0.598 5e-26
85816370182 heat shock protein 20.7 [Locusta migrato 0.653 0.527 0.612 1e-25
359843250182 heat shock protein 20.7 [Schistocerca gr 0.653 0.527 0.622 2e-24
307178750 1004 High affinity cAMP-specific and IBMX-ins 0.585 0.085 0.581 9e-24
239788368174 ACYPI009959 [Acyrthosiphon pisum] 0.523 0.442 0.692 1e-23
301070148189 small heat shock protein [Spodoptera lit 0.659 0.513 0.606 2e-23
91087505192 PREDICTED: similar to heat shock protein 0.680 0.520 0.584 2e-23
148743498185 heat shock protein hsp20.8 [Sesamia nona 0.632 0.502 0.627 5e-23
332376611219 unknown [Dendroctonus ponderosae] 0.551 0.369 0.654 5e-23
>gi|193688392|ref|XP_001951309.1| PREDICTED: protein lethal(2)essential for life-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (78%), Gaps = 5/103 (4%)

Query: 38  EISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITA 97
           EI++KT +G I+VEGKHEEK+DEHGFISRQFKRRYLLPKDV+IE++ SSLSSDG+LT++ 
Sbjct: 93  EITVKTSEGAIIVEGKHEEKQDEHGFISRQFKRRYLLPKDVDIEQIVSSLSSDGILTVSV 152

Query: 98  PKRTLQDKTTERPVPIVQTGVPALKPQAPSSNSSTQQSQPIIT 140
           PK+  Q  T ER VPI+QTG+PA+K      N  T    PI+T
Sbjct: 153 PKKETQ-VTGERSVPIIQTGIPAVKAAEAMKNDET----PIVT 190

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242015113|ref|XP_002428218.1| protein lethal, putative [Pediculus humanus corporis] gi|212512779|gb|EEB15480.1| protein lethal, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|85816370|gb|ABC84494.1| heat shock protein 20.7 [Locusta migratoria] Back     alignment and taxonomy information
>gi|359843250|gb|AEV89760.1| heat shock protein 20.7 [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|307178750|gb|EFN67364.1| High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|239788368|dbj|BAH70870.1| ACYPI009959 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|301070148|gb|ADK55520.1| small heat shock protein [Spodoptera litura] Back     alignment and taxonomy information
>gi|91087505|ref|XP_968760.1| PREDICTED: similar to heat shock protein 1 [Tribolium castaneum] gi|270010666|gb|EFA07114.1| hypothetical protein TcasGA2_TC010105 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|148743498|gb|ABC68342.2| heat shock protein hsp20.8 [Sesamia nonagrioides] Back     alignment and taxonomy information
>gi|332376611|gb|AEE63445.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
FB|FBgn0011296187 l(2)efl "lethal (2) essential 0.591 0.465 0.494 4.2e-15
UNIPROTKB|Q7M2W6175 CRYAB "Alpha-crystallin B chai 0.557 0.468 0.404 6.8e-13
UNIPROTKB|P02510175 CRYAB "Alpha-crystallin B chai 0.557 0.468 0.392 8.6e-13
UNIPROTKB|E2RNB6175 CRYAB "Uncharacterized protein 0.557 0.468 0.392 8.6e-13
UNIPROTKB|E9PR44174 CRYAB "Alpha-crystallin B chai 0.557 0.471 0.392 1.1e-12
UNIPROTKB|P02511175 CRYAB "Alpha-crystallin B chai 0.557 0.468 0.392 1.1e-12
UNIPROTKB|P41316175 CRYAB "Alpha-crystallin B chai 0.557 0.468 0.392 1.1e-12
UNIPROTKB|Q5R9K0175 CRYAB "Alpha-crystallin B chai 0.557 0.468 0.392 1.1e-12
RGD|2414175 Cryab "crystallin, alpha B" [R 0.557 0.468 0.392 1.4e-12
UNIPROTKB|Q5ENY9175 CRYAB "Alpha-crystallin B chai 0.557 0.468 0.392 1.4e-12
FB|FBgn0011296 l(2)efl "lethal (2) essential for life" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 191 (72.3 bits), Expect = 4.2e-15, P = 4.2e-15
 Identities = 44/89 (49%), Positives = 55/89 (61%)

Query:    34 APSHEISIKTVDGFILVXXXXXXXXXXXXFISRQFKRRYLLPKDVEIEKVTSSLSSDGVL 93
             +PS EI++K  D F++V            ++SRQF RRY LP DV  + VTSSLSSDG+L
Sbjct:    89 SPS-EITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLL 147

Query:    94 TITAPKRTLQDKTTERPVPIVQTGVPALK 122
             TI AP + L    TER V I QTG P+ K
Sbjct:   148 TIKAPMKALPPPQTERLVQITQTG-PSSK 175
GO:0009408 "response to heat" evidence=NAS
GO:0009790 "embryo development" evidence=NAS
GO:0010998 "regulation of translational initiation by eIF2 alpha phosphorylation" evidence=IMP
GO:0010506 "regulation of autophagy" evidence=IMP
GO:0006497 "protein lipidation" evidence=IMP
UNIPROTKB|Q7M2W6 CRYAB "Alpha-crystallin B chain" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P02510 CRYAB "Alpha-crystallin B chain" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNB6 CRYAB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PR44 CRYAB "Alpha-crystallin B chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P02511 CRYAB "Alpha-crystallin B chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P41316 CRYAB "Alpha-crystallin B chain" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R9K0 CRYAB "Alpha-crystallin B chain" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|2414 Cryab "crystallin, alpha B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ENY9 CRYAB "Alpha-crystallin B chain" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7M2W6CRYAB_PIGNo assigned EC number0.51190.55780.4685yesN/A
P82147L2EFL_DROMENo assigned EC number0.56840.64620.5080yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
cd0652683 cd06526, metazoan_ACD, Alpha-crystallin domain (AC 4e-32
cd0647883 cd06478, ACD_HspB4-5-6, Alpha-crystallin domain fo 9e-24
cd0647586 cd06475, ACD_HspB1_like, Alpha crystallin domain ( 3e-23
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 1e-21
cd0649884 cd06498, ACD_alphaB-crystallin_HspB5, Alpha-crysta 5e-20
cd0649786 cd06497, ACD_alphaA-crystallin_HspB4, Alpha-crysta 6e-20
cd0647683 cd06476, ACD_HspB2_like, Alpha crystallin domain ( 3e-17
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 4e-17
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 8e-13
cd0647783 cd06477, ACD_HspB3_Like, Alpha crystallin domain ( 1e-12
cd0648091 cd06480, ACD_HspB8_like, Alpha-crystallin domain ( 8e-12
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 4e-08
cd0648187 cd06481, ACD_HspB9_like, Alpha crystallin domain ( 7e-07
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial prote 3e-06
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 2e-05
cd0647981 cd06479, ACD_HspB7_like, Alpha crystallin domain ( 3e-05
cd0647090 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain 4e-05
>gnl|CDD|107247 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information 
 Score =  109 bits (274), Expect = 4e-32
 Identities = 40/63 (63%), Positives = 51/63 (80%)

Query: 37 HEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTIT 96
           E+ +K  D  ++VEGKHEE+EDEHG++SR+F RRY LP+ V+ + VTSSLSSDGVLTI 
Sbjct: 21 EELKVKVSDNKLVVEGKHEEREDEHGYVSREFTRRYQLPEGVDPDSVTSSLSSDGVLTIE 80

Query: 97 APK 99
          APK
Sbjct: 81 APK 83

sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. Length = 83
>gnl|CDD|107233 cd06478, ACD_HspB4-5-6, Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>gnl|CDD|107230 cd06475, ACD_HspB1_like, Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|107246 cd06498, ACD_alphaB-crystallin_HspB5, Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>gnl|CDD|107245 cd06497, ACD_alphaA-crystallin_HspB4, Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>gnl|CDD|107231 cd06476, ACD_HspB2_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|107232 cd06477, ACD_HspB3_Like, Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>gnl|CDD|107235 cd06480, ACD_HspB8_like, Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107236 cd06481, ACD_HspB9_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>gnl|CDD|107234 cd06479, ACD_HspB7_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>gnl|CDD|107227 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.92
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.92
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.92
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.91
KOG3591|consensus173 99.9
PRK10743137 heat shock protein IbpA; Provisional 99.9
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.9
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.89
PRK11597142 heat shock chaperone IbpB; Provisional 99.89
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.88
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.88
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.87
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.87
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.87
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.86
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.84
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.83
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.8
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.78
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.76
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.5
KOG0710|consensus196 99.5
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.18
cd0646384 p23_like Proteins containing this p23_like domain 98.8
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 98.47
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.34
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 97.81
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 97.79
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 97.34
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.13
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.12
cd0646892 p23_CacyBP p23_like domain found in proteins simil 96.94
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 96.77
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 96.36
cd0648887 p23_melusin_like p23_like domain similar to the C- 96.13
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 95.1
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 94.56
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 90.92
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 89.89
KOG1309|consensus196 84.39
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information 
Probab=99.92  E-value=1.5e-24  Score=149.72  Aligned_cols=81  Identities=37%  Similarity=0.735  Sum_probs=74.1

Q ss_pred             cccCCeEEEEEEcCCCCCCCCCCeEEEEECCEEEEEEEEceeeCCcceEEEEEEEEEECCCCcccCCcEEEcCCCCEEEE
Q psy4755          16 IRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTI   95 (147)
Q Consensus        16 ~d~e~~~~l~~~lpDvpG~~~edI~V~v~~~~L~I~g~~~~~~~~~~~~~r~F~R~~~LP~~Vd~~~i~A~~~~dGvL~I   95 (147)
                      .+++++|.|.++||   ||+++||+|++.++.|+|+|++.+..++.+|++++|+|+|.||.+||.++|+|+|++||+|+|
T Consensus         6 ~e~~~~~~v~~dlp---G~~~edi~V~v~~~~L~I~g~~~~~~~~~~~~~~ef~R~~~LP~~Vd~~~i~A~~~~dGvL~I   82 (86)
T cd06497           6 RSDRDKFTIYLDVK---HFSPEDLTVKVLDDYVEIHGKHSERQDDHGYISREFHRRYRLPSNVDQSAITCSLSADGMLTF   82 (86)
T ss_pred             EEcCCEEEEEEECC---CCCHHHeEEEEECCEEEEEEEEcceeCCCCEEEEEEEEEEECCCCCChHHeEEEeCCCCEEEE
Confidence            45899999999877   999999999999999999999876656668999999999999999999999999955999999


Q ss_pred             EEeC
Q psy4755          96 TAPK   99 (147)
Q Consensus        96 ~~PK   99 (147)
                      ++||
T Consensus        83 ~~PK   86 (86)
T cd06497          83 SGPK   86 (86)
T ss_pred             EecC
Confidence            9997

sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1. Only trace amounts of HspB4 are found in tissues other than the lens. HspB5 does not belong to this group. Mutations inHspB4 have been associated with Autosomal Dominant Congenital Cataract (ADCC). The chaperone-like functions of HspB4 are considered important for maintaining lens transparency and preventing cataract.
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>KOG3591|consensus Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG0710|consensus Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>KOG1309|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
2klr_A175 Solid-State Nmr Structure Of The Alpha-Crystallin D 2e-09
3n3e_A106 Zebrafish Alphaa Crystallin Length = 106 1e-08
3l1g_A96 Human Alphab Crystallin Length = 96 1e-08
2wj7_A94 Human Alphab Crystallin Length = 94 5e-08
3l1e_A106 Bovine Alphaa Crystallin Zinc Bound Length = 106 1e-07
3l1f_A103 Bovine Alphaa Crystallin Length = 103 1e-07
2y22_A94 Human Alphab-Crystallin Domain (Residues 67-157) Le 2e-07
2y1y_A90 Human Alphab Crystallin Acd(Residues 71-157) Length 2e-07
2y1z_A94 Human Alphab Crystallin Acd R120g Length = 94 5e-07
3q9p_A85 Hspb1 Fragment Length = 85 6e-07
2wj5_A101 Rat Alpha Crystallin Domain Length = 101 6e-07
>pdb|2KLR|A Chain A, Solid-State Nmr Structure Of The Alpha-Crystallin Domain In Alphab- Crystallin Oligomers Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 2/84 (2%)
Query: 38  EISIKTVDGFILVXXXXXXXXXXXXFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTITA 97
           E+ +K +   I V            FISR+F R+Y +P DV+   +TSSLSSDGVLT+  
Sbjct: 88  ELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNG 147
Query: 98  PKRTLQDKTTERPVPIVQTGVPAL 121
           P++  Q    ER +PI +   PA+
Sbjct: 148 PRK--QVSGPERTIPITREEKPAV 169
>pdb|3N3E|A Chain A, Zebrafish Alphaa Crystallin Length = 106 Back     alignment and structure
>pdb|3L1G|A Chain A, Human Alphab Crystallin Length = 96 Back     alignment and structure
>pdb|2WJ7|A Chain A, Human Alphab Crystallin Length = 94 Back     alignment and structure
>pdb|3L1E|A Chain A, Bovine Alphaa Crystallin Zinc Bound Length = 106 Back     alignment and structure
>pdb|3L1F|A Chain A, Bovine Alphaa Crystallin Length = 103 Back     alignment and structure
>pdb|2Y22|A Chain A, Human Alphab-Crystallin Domain (Residues 67-157) Length = 94 Back     alignment and structure
>pdb|2Y1Y|A Chain A, Human Alphab Crystallin Acd(Residues 71-157) Length = 90 Back     alignment and structure
>pdb|2Y1Z|A Chain A, Human Alphab Crystallin Acd R120g Length = 94 Back     alignment and structure
>pdb|3Q9P|A Chain A, Hspb1 Fragment Length = 85 Back     alignment and structure
>pdb|2WJ5|A Chain A, Rat Alpha Crystallin Domain Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 1e-30
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 3e-29
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 3e-28
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 3e-27
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 5e-27
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 3e-21
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 1e-20
1gme_A151 Heat shock protein 16.9B; small heat shock protein 1e-10
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 1e-09
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 8e-08
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 1e-05
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
 Score =  107 bits (269), Expect = 1e-30
 Identities = 41/88 (46%), Positives = 58/88 (65%), Gaps = 2/88 (2%)

Query: 37  HEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTIT 96
            E+ +K +   I V GKHEE++DEHGFISR+F R+Y +P DV+   +TSSLSSDGVLT+ 
Sbjct: 87  EELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVN 146

Query: 97  APKRTLQDKTTERPVPIVQTGVPALKPQ 124
            P++ +     ER +PI +   PA+   
Sbjct: 147 GPRKQVSGP--ERTIPITREEKPAVTAA 172
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.93
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.92
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.92
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.92
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.9
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.87
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.86
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.86
4fei_A102 Heat shock protein-related protein; stress respons 99.85
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.84
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.83
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.75
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 98.56
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 98.55
3igf_A374 ALL4481 protein; two-domained protein consisting o 97.38
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.25
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 96.91
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 96.78
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 96.59
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 96.17
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 96.04
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 95.96
2o30_A131 Nuclear movement protein; MCSG, structural genomic 95.9
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 95.9
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 95.56
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 94.53
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 93.37
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
Probab=99.93  E-value=1.3e-25  Score=159.19  Aligned_cols=96  Identities=32%  Similarity=0.638  Sum_probs=85.7

Q ss_pred             cccCCeEEEEEEcCCCCCCCCCCeEEEEECCEEEEEEEEceeeCCcceEEEEEEEEEECCCCcccCCcEEEcCCCCEEEE
Q psy4755          16 IRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGKHEEKEDEHGFISRQFKRRYLLPKDVEIEKVTSSLSSDGVLTI   95 (147)
Q Consensus        16 ~d~e~~~~l~~~lpDvpG~~~edI~V~v~~~~L~I~g~~~~~~~~~~~~~r~F~R~~~LP~~Vd~~~i~A~~~~dGvL~I   95 (147)
                      .+++++|+|.++||   ||+++||+|+++++.|+|+|+++...++.+|++++|+|+|.||.+||.++|+|+|++||+|+|
T Consensus         8 ~e~~~~~~v~~dlP---G~~~edi~V~v~~~~L~I~g~~~~~~~~~~~~~~eF~R~~~LP~~vd~~~i~A~~s~~GvL~I   84 (106)
T 3l1e_A            8 RSDRDKFVIFLDVK---HFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTF   84 (106)
T ss_dssp             EECSSEEEEEEECT---TSCGGGEEEEEETTEEEEEEEEEEEETTTEEEEEEEEEEEECCTTBCTTSCEEEECTTSEEEE
T ss_pred             EEcCCEEEEEEECC---CCChHHEEEEEECCEEEEEEEEccccCCCCEEEEEEEEEEECCCCcChhHcEEEECCCCEEEE
Confidence            45899999999887   999999999999999999999877666778999999999999999999999999944999999


Q ss_pred             EEeCcCCCC--CCCCeEEeee
Q psy4755          96 TAPKRTLQD--KTTERPVPIV  114 (147)
Q Consensus        96 ~~PK~~~~~--~~~~r~I~I~  114 (147)
                      ++||..+..  ...+|+|+|+
T Consensus        85 ~~PK~~~~~~~~~~~r~I~I~  105 (106)
T 3l1e_A           85 SGPKIPSGVDAGHSERAIPVS  105 (106)
T ss_dssp             EEEBCCCCTTTTSSSCCCCCC
T ss_pred             EEEccCcccccCCCCeEeeec
Confidence            999998742  1378999996
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 3e-07
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 5e-06
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

 Score = 44.8 bits (105), Expect = 3e-07
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 10/89 (11%)

Query: 33  GAPSHEISIKTVDGFILVEGKHEEKEDEH--------GFISRQFKRRYLLPKDVEIEKVT 84
           G    E+ ++  DG +LV      KE E            S +F RR+ L +D ++E+V 
Sbjct: 62  GVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEVK 121

Query: 85  SSLSSDGVLTITAPKRTLQDKTTERPVPI 113
           + L  +GVLT+T PK     K   + + I
Sbjct: 122 AGLE-NGVLTVTVPKAE-VKKPEVKAIQI 148
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.85
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.83
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 97.47
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 95.41
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 94.82
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 94.77
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 94.67
d1rl6a175 Ribosomal protein L6 {Bacillus stearothermophilus 84.54
d1vqoe179 Ribosomal protein L6 {Archaeon Haloarcula marismor 84.0
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.85  E-value=5.3e-21  Score=134.57  Aligned_cols=92  Identities=20%  Similarity=0.363  Sum_probs=77.4

Q ss_pred             cccCCeEEEEEEcCCCCCCCCCCeEEEEECCEEEEEEEEceee--CCcceE------EEEEEEEEECCCCcccCCcEEEc
Q psy4755          16 IRKPRALTLPFCIPSFLGAPSHEISIKTVDGFILVEGKHEEKE--DEHGFI------SRQFKRRYLLPKDVEIEKVTSSL   87 (147)
Q Consensus        16 ~d~e~~~~l~~~lpDvpG~~~edI~V~v~~~~L~I~g~~~~~~--~~~~~~------~r~F~R~~~LP~~Vd~~~i~A~~   87 (147)
                      .+++++|+|.++||   ||+++||+|.++++.|+|+|++....  +..++.      .+.|+|+|.||.+||.++++|.|
T Consensus        16 ~e~~~~~~i~~~lP---G~~~edi~v~v~~~~l~I~~~~~~~~~~~~~~~~~~~~~~~~~f~r~~~lP~~vd~~~i~A~~   92 (115)
T d1shsa_          16 IEGDQHIKVIAWLP---GVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKF   92 (115)
T ss_dssp             EECSSEEEEEEECT---TCCGGGEEEEEETTEEEEEEECCCCCCCTTCEEEEECSCCCCEEEEEEECSSCBCGGGCEEEE
T ss_pred             EEcCCEEEEEEECC---CCCHHHEEEEEECCEEEEEEEeccccccccccEEEEeeecccceEEEEecCCceeecceEEEE
Confidence            45999999999987   99999999999999999999875432  222232      24799999999999999999999


Q ss_pred             CCCCEEEEEEeCcCCCCCCCCeEEeee
Q psy4755          88 SSDGVLTITAPKRTLQDKTTERPVPIV  114 (147)
Q Consensus        88 ~~dGvL~I~~PK~~~~~~~~~r~I~I~  114 (147)
                      . ||+|+|++||.+.   ...++|.|+
T Consensus        93 ~-nGvL~I~lpK~~~---~~~~~I~Ie  115 (115)
T d1shsa_          93 E-NGVLSVILPKAES---SIKKGINIE  115 (115)
T ss_dssp             E-TTEEEEEEEBCGG---GCCEECCCC
T ss_pred             E-CCEEEEEEEeCCC---CCCceeeeC
Confidence            5 9999999999876   467888875
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vqoe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure