Diaphorina citri psyllid: psy4772


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MTDSSSDEDNEIWVYYKNREEWKDLRPIPQDDGPTPVVAIAYSQKCNLFSDELSYIEGLISHDVRNNSAWTQRYFVINHTTQFTPEVIQREIDYCRDKIQIAPKNESPWNYLRGAVVNAGEKSERALALTADAITMNPANYTVWQYRREILKALNKDLHQELKYIGEKIKENSKNYQVWRHRQIIVEWMGEPDEELALTAAILAQDAKNYHAWQHRQWVINLLDDDDRGVLEYET
ccccccccccccccccccccccccccccccccccccHHHHHcccHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHccc
***********IWVYYKNREEWKDLRPIPQDDGPTPVVAIAYSQKCNLFSDELSYIEGLISHDVRNNSAWTQRYFVINHTTQFTPEVIQREIDYCRDKIQIAPKNESPWNYLRGAVVNAGEKSERALALTADAITMNPANYTVWQYRREILKALNKDLHQELKYIGEKIKENSKNYQVWRHRQIIVEWMGEPDEELALTAAILAQDAKNYHAWQHRQWVINLLDDDDRGVLEYET
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDSSSDEDNEIWVYYKNREEWKDLRPIPQDDGPTPVVAIAYSQKCNLFSDELSYIEGLISHDVRNNSAWTQRYFVINHTTQFTPEVIQREIDYCRDKIQIAPKNESPWNYLRGAVVNAGEKSERALALTADAITMNPANYTVWQYRREILKALNKDLHQELKYIGEKIKENSKNYQVWRHRQIIVEWMGEPDEELALTAAILAQDAKNYHAWQHRQWVINLLDDDDRGVLEYET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate. Through RAC1 prenylation and activation may positively regulate neuromuscular junction development downstream of MUSK.confidentP49354
Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate. Through RAC1 prenylation and activation may positively regulate neuromuscular junction development downstream of MUSK.confidentQ61239
Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate. Through RAC1 prenylation and activation may positively regulate neuromuscular junction development downstream of MUSK.confidentP29702

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005953 [CC]CAAX-protein geranylgeranyltransferase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0090045 [BP]positive regulation of deacetylase activityprobableGO:0051336, GO:0051345, GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0090044 [BP]positive regulation of tubulin deacetylationprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0090043, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0060255, GO:0090312, GO:0090311, GO:0050794, GO:0008150, GO:0032268, GO:0031401, GO:0048522
GO:0004663 [MF]Rab geranylgeranyltransferase activityprobableGO:0004659, GO:0003824, GO:0016765, GO:0016740, GO:0003674, GO:0004661, GO:0008318
GO:0004660 [MF]protein farnesyltransferase activityprobableGO:0004659, GO:0003824, GO:0016765, GO:0016740, GO:0003674, GO:0008318
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0043014 [MF]alpha-tubulin bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0042277 [MF]peptide bindingprobableGO:0033218, GO:0003674, GO:0005488
GO:0018343 [BP]protein farnesylationprobableGO:0044267, GO:0018342, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0097354, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0018344 [BP]protein geranylgeranylationprobableGO:0044267, GO:0018342, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0097354, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0019840 [MF]isoprenoid bindingprobableGO:0003674, GO:0008289, GO:0005488
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DRA, chain A
Confidence level:very confident
Coverage over the Query: 18-230
View the alignment between query and template
View the model in PyMOL
Template: 2H6F, chain A
Confidence level:very confident
Coverage over the Query: 5-225
View the alignment between query and template
View the model in PyMOL