Diaphorina citri psyllid: psy4774


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MFDGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKQTDKLGAK
ccccccccccccccccEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccccccccccccCEEcccccEEEECccccccccccEEEEECccccEEEEEcccccEEEEEEEcccccc
**DGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKQTDKLG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKQTDKLGAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0009505 [CC]plant-type cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QC5, chain A
Confidence level:very confident
Coverage over the Query: 11-80
View the alignment between query and template
View the model in PyMOL
Template: 2FP8, chain A
Confidence level:very confident
Coverage over the Query: 10-113
View the alignment between query and template
View the model in PyMOL