Psyllid ID: psy4774
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| 328714072 | 412 | PREDICTED: LOW QUALITY PROTEIN: adipocyt | 0.883 | 0.257 | 0.504 | 1e-25 | |
| 270011245 | 486 | hypothetical protein TcasGA2_TC030782, p | 0.875 | 0.216 | 0.514 | 2e-25 | |
| 91087333 | 503 | PREDICTED: similar to hemomucin [Triboli | 0.875 | 0.208 | 0.514 | 2e-25 | |
| 215541377 | 423 | putative hemomucin [Schistocerca gregari | 0.891 | 0.252 | 0.541 | 1e-24 | |
| 156551049 | 544 | PREDICTED: adipocyte plasma membrane-ass | 0.883 | 0.194 | 0.5 | 8e-24 | |
| 383859542 | 572 | PREDICTED: adipocyte plasma membrane-ass | 0.916 | 0.192 | 0.464 | 2e-21 | |
| 307210789 | 587 | Adipocyte plasma membrane-associated pro | 0.825 | 0.168 | 0.454 | 5e-21 | |
| 332027099 | 578 | Adipocyte plasma membrane-associated pro | 0.883 | 0.183 | 0.424 | 7e-21 | |
| 380024889 | 592 | PREDICTED: adipocyte plasma membrane-ass | 0.916 | 0.185 | 0.437 | 1e-20 | |
| 328784314 | 590 | PREDICTED: LOW QUALITY PROTEIN: adipocyt | 0.916 | 0.186 | 0.437 | 2e-20 |
| >gi|328714072|ref|XP_001947674.2| PREDICTED: LOW QUALITY PROTEIN: adipocyte plasma membrane-associated protein-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 120 bits (301), Expect = 1e-25, Method: Compositional matrix adjust.
Identities = 55/109 (50%), Positives = 74/109 (67%), Gaps = 3/109 (2%)
Query: 3 DGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTT---GQTEQLISMDTEIDGAKP 59
DG E CGRPLG+ DK G L+VADAY+G++KVN+ G+ EQL+S+D IDG P
Sbjct: 109 DGLYDEHICGRPLGLSMDKTGFLYVADAYYGIFKVNLNPDQYGKKEQLVSLDDVIDGVHP 168
Query: 60 QIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQE 108
++PNSV + SDG +YW+DS T YKL+DGL+ G+G +K P T+
Sbjct: 169 KLPNSVAIASDGTLYWTDSDTNYKLHDGLYTLFVDGTGRLLKYDPKTKR 217
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270011245|gb|EFA07693.1| hypothetical protein TcasGA2_TC030782, partial [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91087333|ref|XP_975599.1| PREDICTED: similar to hemomucin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|215541377|emb|CAT00690.1| putative hemomucin [Schistocerca gregaria] | Back alignment and taxonomy information |
|---|
| >gi|156551049|ref|XP_001605615.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383859542|ref|XP_003705253.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307210789|gb|EFN87172.1| Adipocyte plasma membrane-associated protein [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332027099|gb|EGI67195.1| Adipocyte plasma membrane-associated protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380024889|ref|XP_003696221.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328784314|ref|XP_003250432.1| PREDICTED: LOW QUALITY PROTEIN: adipocyte plasma membrane-associated protein [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| UNIPROTKB|G1K318 | 414 | C3H20orf3 "Uncharacterized pro | 0.85 | 0.246 | 0.427 | 5.7e-16 | |
| UNIPROTKB|Q5ZIF1 | 415 | APMAP "Adipocyte plasma membra | 0.85 | 0.245 | 0.432 | 7.4e-16 | |
| FB|FBgn0015737 | 582 | Hmu "Hemomucin" [Drosophila me | 0.858 | 0.176 | 0.409 | 5.3e-14 | |
| ZFIN|ZDB-GENE-020919-1 | 415 | apmap "adipocyte plasma membra | 0.866 | 0.250 | 0.367 | 1.9e-13 | |
| TAIR|locus:2201841 | 390 | SSL3 "strictosidine synthase-l | 0.866 | 0.266 | 0.387 | 3.5e-13 | |
| UNIPROTKB|F1SAS3 | 400 | LOC100157249 "Uncharacterized | 0.85 | 0.255 | 0.394 | 6.2e-13 | |
| UNIPROTKB|Q3T0E5 | 412 | APMAP "Adipocyte plasma membra | 0.841 | 0.245 | 0.4 | 8.6e-13 | |
| MGI|MGI:1919131 | 415 | Apmap "adipocyte plasma membra | 0.85 | 0.245 | 0.384 | 1.9e-12 | |
| RGD|1308874 | 376 | Apmap "adipocyte plasma membra | 0.85 | 0.271 | 0.375 | 1.9e-12 | |
| UNIPROTKB|F1LLW3 | 386 | RGD1308874 "Protein RGD1308874 | 0.85 | 0.264 | 0.375 | 2e-12 |
| UNIPROTKB|G1K318 C3H20orf3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 205 (77.2 bits), Expect = 5.7e-16, P = 5.7e-16
Identities = 44/103 (42%), Positives = 63/103 (61%)
Query: 8 EQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTV 67
E CGRPLG++ N L VADAY+GLY+VN TG+T+ L+S T I+G K N +TV
Sbjct: 145 EPTCGRPLGIRVGPNNTLFVADAYYGLYEVNPGTGETKMLVSTKTLIEGQKLSFLNDLTV 204
Query: 68 DSDGM-VYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEV 109
DG +Y++DSS+K++ D LF + ++ T+EV
Sbjct: 205 TQDGRKIYFTDSSSKWQRRDFLFLVMEGTDDGLLEYDTVTKEV 247
|
|
| UNIPROTKB|Q5ZIF1 APMAP "Adipocyte plasma membrane-associated protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0015737 Hmu "Hemomucin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020919-1 apmap "adipocyte plasma membrane associated protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201841 SSL3 "strictosidine synthase-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SAS3 LOC100157249 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0E5 APMAP "Adipocyte plasma membrane-associated protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919131 Apmap "adipocyte plasma membrane associated protein" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308874 Apmap "adipocyte plasma membrane associated protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LLW3 RGD1308874 "Protein RGD1308874" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| pfam03088 | 89 | pfam03088, Str_synth, Strictosidine synthase | 7e-04 | |
| COG3386 | 307 | COG3386, COG3386, Gluconolactonase [Carbohydrate t | 7e-04 |
| >gnl|CDD|111929 pfam03088, Str_synth, Strictosidine synthase | Back alignment and domain information |
|---|
Score = 35.8 bits (83), Expect = 7e-04
Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
Query: 63 NSVTVDSD-GMVYWSDSSTKYKLYDGLFDGLTS-GSGSFIKIGPNTQEV 109
N++ VD + G++Y++DSS++Y +F L +G +K P+T+
Sbjct: 1 NALDVDPETGVLYFTDSSSRYDRRQVIFAMLEGDKTGRLMKYDPSTKVT 49
|
Strictosidine synthase (E.C. 4.3.3.2) is a key enzyme in alkaloid biosynthesis. It catalyzes the condensation of tryptamine with secologanin to form strictosidine. Length = 89 |
| >gnl|CDD|225921 COG3386, COG3386, Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| KOG1520|consensus | 376 | 99.95 | ||
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 99.52 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 99.36 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 99.19 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 98.92 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.88 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.87 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 98.81 | |
| COG4257 | 353 | Vgb Streptogramin lyase [Defense mechanisms] | 98.79 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 98.7 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 98.65 | |
| COG4257 | 353 | Vgb Streptogramin lyase [Defense mechanisms] | 98.57 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 98.42 | |
| KOG4659|consensus | 1899 | 98.25 | ||
| KOG4659|consensus | 1899 | 98.25 | ||
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 97.99 | |
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 97.81 | |
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 97.74 | |
| KOG4499|consensus | 310 | 97.69 | ||
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 97.63 | |
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 97.6 | |
| KOG1520|consensus | 376 | 97.47 | ||
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 97.34 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 97.2 | |
| COG2133 | 399 | Glucose/sorbosone dehydrogenases [Carbohydrate tra | 97.0 | |
| PF05787 | 524 | DUF839: Bacterial protein of unknown function (DUF | 96.93 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 96.78 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 96.77 | |
| COG3211 | 616 | PhoX Predicted phosphatase [General function predi | 96.77 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 96.72 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 96.71 | |
| TIGR03032 | 335 | conserved hypothetical protein TIGR03032. This pro | 96.69 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 96.58 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 96.55 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 96.51 | |
| TIGR03606 | 454 | non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH | 96.48 | |
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 96.39 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 96.39 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 96.35 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 96.16 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 96.1 | |
| COG3823 | 262 | Glutamine cyclotransferase [Posttranslational modi | 96.08 | |
| COG3204 | 316 | Uncharacterized protein conserved in bacteria [Fun | 96.04 | |
| KOG4499|consensus | 310 | 95.95 | ||
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 95.82 | |
| PF06739 | 38 | SBBP: Beta-propeller repeat; InterPro: IPR010620 T | 95.57 | |
| TIGR03606 | 454 | non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH | 95.54 | |
| COG3211 | 616 | PhoX Predicted phosphatase [General function predi | 95.47 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 95.21 | |
| KOG1214|consensus | 1289 | 95.13 | ||
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 95.12 | |
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 94.69 | |
| PF13449 | 326 | Phytase-like: Esterase-like activity of phytase | 94.34 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 94.18 | |
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 94.17 | |
| PF06739 | 38 | SBBP: Beta-propeller repeat; InterPro: IPR010620 T | 94.07 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 93.96 | |
| PF05787 | 524 | DUF839: Bacterial protein of unknown function (DUF | 93.58 | |
| COG2133 | 399 | Glucose/sorbosone dehydrogenases [Carbohydrate tra | 93.52 | |
| PF14269 | 299 | Arylsulfotran_2: Arylsulfotransferase (ASST) | 93.16 | |
| KOG1214|consensus | 1289 | 93.05 | ||
| PF14339 | 236 | DUF4394: Domain of unknown function (DUF4394) | 92.92 | |
| PF14517 | 229 | Tachylectin: Tachylectin; PDB: 1TL2_A. | 92.7 | |
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 92.61 | |
| PF02333 | 381 | Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 | 92.33 | |
| TIGR02276 | 42 | beta_rpt_yvtn 40-residue YVTN family beta-propelle | 91.18 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 91.14 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 91.08 | |
| PF13449 | 326 | Phytase-like: Esterase-like activity of phytase | 90.78 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 89.14 | |
| TIGR03032 | 335 | conserved hypothetical protein TIGR03032. This pro | 89.11 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 89.09 | |
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 88.82 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 88.7 | |
| TIGR03803 | 34 | Gloeo_Verruco Gloeo_Verruco repeat. This model des | 88.7 | |
| KOG1446|consensus | 311 | 88.66 | ||
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 88.6 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 88.59 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 88.38 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 87.92 | |
| COG3204 | 316 | Uncharacterized protein conserved in bacteria [Fun | 87.56 | |
| smart00284 | 255 | OLF Olfactomedin-like domains. | 87.46 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 87.11 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 86.97 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 86.96 | |
| KOG0266|consensus | 456 | 86.85 | ||
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 86.68 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 86.36 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 86.32 | |
| KOG3567|consensus | 501 | 85.9 | ||
| PF07494 | 24 | Reg_prop: Two component regulator propeller; Inter | 85.57 | |
| PF14517 | 229 | Tachylectin: Tachylectin; PDB: 1TL2_A. | 85.53 | |
| cd00216 | 488 | PQQ_DH Dehydrogenases with pyrrolo-quinoline quino | 85.43 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 85.31 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 85.28 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 85.1 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 84.88 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 84.81 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 84.67 | |
| KOG0272|consensus | 459 | 84.48 | ||
| PRK12690 | 238 | flgF flagellar basal body rod protein FlgF; Review | 84.41 | |
| TIGR03075 | 527 | PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan | 83.99 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 83.84 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 83.6 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 83.6 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 83.59 | |
| KOG0319|consensus | 775 | 83.22 | ||
| PF14583 | 386 | Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C | 83.19 | |
| PRK12689 | 253 | flgF flagellar basal body rod protein FlgF; Review | 83.03 | |
| PF14269 | 299 | Arylsulfotran_2: Arylsulfotransferase (ASST) | 83.0 | |
| smart00564 | 33 | PQQ beta-propeller repeat. Beta-propeller repeat o | 82.9 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 82.84 | |
| COG1520 | 370 | FOG: WD40-like repeat [Function unknown] | 82.71 | |
| PRK12636 | 263 | flgG flagellar basal body rod protein FlgG; Provis | 81.78 | |
| COG3292 | 671 | Predicted periplasmic ligand-binding sensor domain | 81.36 | |
| KOG4649|consensus | 354 | 81.05 | ||
| smart00284 | 255 | OLF Olfactomedin-like domains. | 80.76 | |
| TIGR03074 | 764 | PQQ_membr_DH membrane-bound PQQ-dependent dehydrog | 80.59 |
| >KOG1520|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=6.7e-28 Score=187.50 Aligned_cols=109 Identities=41% Similarity=0.706 Sum_probs=102.1
Q ss_pred CcccccCCCCccceEECCCC-cEEEEECCCCEEEEECCCCcEEEEeccccccCCCCCcCCCceEEcCCCCEEEEeCCCCc
Q psy4774 4 GFKYEQQCGRPLGMKFDKNG-ALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKY 82 (120)
Q Consensus 4 ~~~~~~~~g~P~Gl~~d~~G-~l~V~d~~~gi~~vd~~~g~~~~~~~~~~~~~g~~~~~pndl~v~~~G~iy~TDs~~~~ 82 (120)
..++++.||||+||+|+.+| +|||||++.|+++|++++|+.+.+++ +.+|+|+.+.|+++|+++|.||||||+.+|
T Consensus 107 ~~~~e~~CGRPLGl~f~~~ggdL~VaDAYlGL~~V~p~g~~a~~l~~---~~~G~~~kf~N~ldI~~~g~vyFTDSSsk~ 183 (376)
T KOG1520|consen 107 SFETEPLCGRPLGIRFDKKGGDLYVADAYLGLLKVGPEGGLAELLAD---EAEGKPFKFLNDLDIDPEGVVYFTDSSSKY 183 (376)
T ss_pred ceecccccCCcceEEeccCCCeEEEEecceeeEEECCCCCcceeccc---cccCeeeeecCceeEcCCCeEEEecccccc
Confidence 78889999999999999998 99999999999999999888777775 789999999999999999999999999999
Q ss_pred ccccceecce-ecCCceEEEEcCCC--ceEecCccc
Q psy4774 83 KLYDGLFDGL-TSGSGSFIKIGPNT--QEVLQKQTD 115 (120)
Q Consensus 83 ~~~~~~~~~~-~~~~G~l~~~d~~~--~~~l~~~L~ 115 (120)
++++++.+++ ..++|||++|||.+ +++|+++|.
T Consensus 184 ~~rd~~~a~l~g~~~GRl~~YD~~tK~~~VLld~L~ 219 (376)
T KOG1520|consen 184 DRRDFVFAALEGDPTGRLFRYDPSTKVTKVLLDGLY 219 (376)
T ss_pred chhheEEeeecCCCccceEEecCcccchhhhhhccc
Confidence 9999999887 68999999999999 889999985
|
|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >COG4257 Vgb Streptogramin lyase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4257 Vgb Streptogramin lyase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >KOG4659|consensus | Back alignment and domain information |
|---|
| >KOG4659|consensus | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >KOG4499|consensus | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >KOG1520|consensus | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >COG3211 PhoX Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >TIGR03032 conserved hypothetical protein TIGR03032 | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3204 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4499|consensus | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller | Back alignment and domain information |
|---|
| >TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family | Back alignment and domain information |
|---|
| >COG3211 PhoX Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >PF13449 Phytase-like: Esterase-like activity of phytase | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF14339 DUF4394: Domain of unknown function (DUF4394) | Back alignment and domain information |
|---|
| >PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 | Back alignment and domain information |
|---|
| >TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF13449 Phytase-like: Esterase-like activity of phytase | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >TIGR03032 conserved hypothetical protein TIGR03032 | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >TIGR03803 Gloeo_Verruco Gloeo_Verruco repeat | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >COG3204 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >smart00284 OLF Olfactomedin-like domains | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG3567|consensus | Back alignment and domain information |
|---|
| >PF07494 Reg_prop: Two component regulator propeller; InterPro: IPR011110 A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats | Back alignment and domain information |
|---|
| >PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A | Back alignment and domain information |
|---|
| >cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed | Back alignment and domain information |
|---|
| >TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A | Back alignment and domain information |
|---|
| >PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed | Back alignment and domain information |
|---|
| >PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) | Back alignment and domain information |
|---|
| >smart00564 PQQ beta-propeller repeat | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >COG1520 FOG: WD40-like repeat [Function unknown] | Back alignment and domain information |
|---|
| >PRK12636 flgG flagellar basal body rod protein FlgG; Provisional | Back alignment and domain information |
|---|
| >COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4649|consensus | Back alignment and domain information |
|---|
| >smart00284 OLF Olfactomedin-like domains | Back alignment and domain information |
|---|
| >TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 2e-21 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 9e-08 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 3e-05 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 4e-05 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 1e-04 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 2e-04 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 3e-05 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 2e-04 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 2e-04 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 2e-04 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 8e-05 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 7e-04 |
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Length = 322 | Back alignment and structure |
|---|
Score = 85.5 bits (211), Expect = 2e-21
Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 6/108 (5%)
Query: 5 FKYEQQCGRPLGMKFD-KNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPN 63
+ CGR + ++ +N L++ D Y+ L V G QL T +DG +
Sbjct: 73 AEKRPLCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLA---TSVDGVPFKWLY 129
Query: 64 SVTVD-SDGMVYWSDSSTKYKLYDGLFDGLT-SGSGSFIKIGPNTQEV 109
+VTVD G+VY++D ST Y T +G IK P+T+E
Sbjct: 130 AVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLIKYDPSTKET 177
|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Length = 314 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 99.58 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 99.33 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 99.27 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 99.2 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 99.14 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 99.14 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 99.1 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 99.05 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 98.99 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 98.98 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 98.98 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 98.96 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 98.94 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 98.94 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 98.91 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 98.91 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 98.88 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 98.87 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 98.86 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 98.86 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 98.84 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 98.83 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 98.8 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.8 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.79 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 98.79 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 98.78 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 98.78 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 98.78 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 98.78 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 98.77 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 98.75 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 98.75 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 98.75 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 98.74 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 98.73 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 98.73 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.72 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 98.72 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.72 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 98.7 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 98.7 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.69 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 98.68 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 98.67 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 98.67 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 98.67 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 98.66 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 98.64 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.61 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 98.61 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 98.59 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 98.59 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.59 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.56 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 98.51 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 98.49 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 98.44 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 98.43 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 98.39 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 98.37 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 98.36 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 98.36 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 98.34 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 98.31 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 98.29 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 98.21 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 98.15 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 98.13 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 98.13 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 98.13 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 98.12 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 98.09 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 98.08 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 97.9 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 97.88 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 97.88 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 97.84 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 97.79 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 97.79 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 97.78 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 97.78 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 97.71 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 97.7 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 97.69 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 97.69 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 97.68 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 97.65 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 97.65 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 97.62 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 97.52 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 97.49 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 97.44 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 97.42 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 97.4 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 97.38 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 97.35 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.34 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 97.34 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 97.29 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 97.28 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 97.25 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 97.24 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 97.24 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.2 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 97.18 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 97.13 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 97.07 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 97.04 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 97.02 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 96.95 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 96.93 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 96.8 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 96.72 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 96.62 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 96.56 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 96.55 | |
| 3ott_A | 758 | Two-component system sensor histidine kinase; beta | 96.47 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 96.47 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 96.43 | |
| 3zwu_A | 592 | Alkaline phosphatase PHOX; hydrolase, beta-propell | 96.37 | |
| 3zwu_A | 592 | Alkaline phosphatase PHOX; hydrolase, beta-propell | 96.33 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 96.3 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 96.21 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 96.19 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 96.18 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 96.18 | |
| 3amr_A | 355 | 3-phytase; beta-propeller, phytate, MYO-inositol h | 96.13 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 96.1 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 96.03 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 95.97 | |
| 3ott_A | 758 | Two-component system sensor histidine kinase; beta | 95.83 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 95.81 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 95.38 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 95.24 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 95.23 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 94.99 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 94.7 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 94.62 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 94.47 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 94.13 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 94.06 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 93.97 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 93.6 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 93.52 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 92.96 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 92.79 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 92.75 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 92.51 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 92.38 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 92.32 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 92.29 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 92.12 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 92.06 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 92.05 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 91.75 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 91.6 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 91.56 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 91.49 | |
| 3amr_A | 355 | 3-phytase; beta-propeller, phytate, MYO-inositol h | 91.18 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 91.14 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 90.94 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 90.4 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 90.22 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 90.18 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 90.18 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 90.11 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 90.08 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 90.06 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 89.92 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 89.33 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 89.32 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 89.08 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 88.66 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 88.36 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 88.35 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 87.85 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 87.71 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 87.35 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 87.3 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 87.2 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 86.48 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 86.36 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 86.34 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 86.32 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 86.16 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 86.08 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 85.31 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 85.07 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 84.8 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 84.46 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 84.46 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 84.43 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 84.43 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 84.41 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 84.33 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 84.24 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 84.07 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 84.03 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 83.78 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 83.66 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 83.54 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 83.46 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 83.36 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 83.25 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 83.01 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 82.88 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 82.85 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 82.8 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 82.74 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 82.34 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 82.19 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 81.98 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 81.92 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 81.86 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 81.72 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 81.66 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 81.35 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 81.23 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 80.87 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 80.24 |
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
Probab=99.58 E-value=1.2e-15 Score=114.05 Aligned_cols=101 Identities=32% Similarity=0.486 Sum_probs=78.1
Q ss_pred CCCCccceEECC-CCcEEEEECCCCEEEEECCCCcEEEEeccccccCCCCCcCCCceEEcC-CCCEEEEeCCCCcccccc
Q psy4774 10 QCGRPLGMKFDK-NGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDS-DGMVYWSDSSTKYKLYDG 87 (120)
Q Consensus 10 ~~g~P~Gl~~d~-~G~l~V~d~~~gi~~vd~~~g~~~~~~~~~~~~~g~~~~~pndl~v~~-~G~iy~TDs~~~~~~~~~ 87 (120)
.+++|.||++++ +|+|||||...+|++++++++++++++. ...+.+++.||++++++ +|+|||||+...|.+.++
T Consensus 78 ~~~~p~gi~~~~~~g~l~v~d~~~~i~~~d~~~g~~~~~~~---~~~~~~~~~p~~i~~d~~~G~l~v~d~~~~~~~~~~ 154 (322)
T 2fp8_A 78 LCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLAT---SVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGV 154 (322)
T ss_dssp HHCCEEEEEEETTTTEEEEEETTTEEEEECTTCEECEEEES---EETTEECSCEEEEEECTTTCCEEEEESCSSCCTTCH
T ss_pred cCCCCceEEEcCCCCcEEEEECCCCEEEEeCCCCEEEEecc---cCCCCcccccceEEEecCCCEEEEECCccccccccc
Confidence 457899999997 8999999998889999998777777764 34566788999999999 999999999865554433
Q ss_pred eecce-ecCCceEEEEcCCC--ceEecCc
Q psy4774 88 LFDGL-TSGSGSFIKIGPNT--QEVLQKQ 113 (120)
Q Consensus 88 ~~~~~-~~~~G~l~~~d~~~--~~~l~~~ 113 (120)
..... ..+.|+|+++|+++ ++++.++
T Consensus 155 ~~~~~~~~~~g~v~~~d~~~~~~~~~~~~ 183 (322)
T 2fp8_A 155 QQIMDTSDKTGRLIKYDPSTKETTLLLKE 183 (322)
T ss_dssp HHHHHHTCCCEEEEEEETTTTEEEEEEEE
T ss_pred ceehcccCCCceEEEEeCCCCEEEEeccC
Confidence 33322 35678999999875 5555544
|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 99.64 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 99.24 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 99.11 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 99.06 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 98.99 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 98.88 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 98.86 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 98.85 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 98.78 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 98.72 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 98.69 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 98.65 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 98.62 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 98.5 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 98.48 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 98.41 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 98.37 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 97.53 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 97.46 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 97.37 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 97.25 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 97.16 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 97.12 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 96.99 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 96.95 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 96.81 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 96.61 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 96.25 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 96.18 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 95.93 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 95.86 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 95.76 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 95.35 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 95.15 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 94.71 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 94.24 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 93.99 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 93.6 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 93.24 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 93.11 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 92.19 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 92.11 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 92.07 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 90.83 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 90.32 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 89.98 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 89.84 | |
| d1tl2a_ | 235 | Tachylectin-2 {Japanese horseshoe crab (Tachypleus | 89.41 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 89.4 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 88.97 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 88.8 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 88.73 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 87.68 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 87.6 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 87.52 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 86.97 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 86.67 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 85.52 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 84.58 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 84.28 | |
| d1flga_ | 582 | Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax | 84.17 | |
| d1kb0a2 | 573 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 83.97 | |
| d2ad6a1 | 571 | Methanol dehydrogenase, heavy chain {Methylophilus | 83.9 | |
| d1kv9a2 | 560 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 83.68 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 83.39 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 80.09 |
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: Calcium-dependent phosphotriesterase family: SGL-like domain: Diisopropylfluorophosphatase (phosphotriesterase, DFP) species: Squid (Loligo vulgaris) [TaxId: 6622]
Probab=99.64 E-value=4.7e-16 Score=115.72 Aligned_cols=101 Identities=20% Similarity=0.248 Sum_probs=76.0
Q ss_pred CCCCccceEECCCCc-EEEEECCCCEEEEECCCCcEEEEeccccccCCCCCcCCCceEEcCCCCEEEEeCCCCcccccce
Q psy4774 10 QCGRPLGMKFDKNGA-LHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGL 88 (120)
Q Consensus 10 ~~g~P~Gl~~d~~G~-l~V~d~~~gi~~vd~~~g~~~~~~~~~~~~~g~~~~~pndl~v~~~G~iy~TDs~~~~~~~~~~ 88 (120)
..++|+||+++++|+ |||++..++|+++++++ ....++.. ..++.+++.|||++++++|+|||||+...+......
T Consensus 69 ~~g~P~Gl~~~~dg~~l~vad~~~~i~~~~~~g-~~~~~~~~--~~~g~~~~~pndl~~d~~G~lyvtd~~~~~~~~~~~ 145 (314)
T d1pjxa_ 69 YGGIPAGCQCDRDANQLFVADMRLGLLVVQTDG-TFEEIAKK--DSEGRRMQGCNDCAFDYEGNLWITAPAGEVAPADYT 145 (314)
T ss_dssp EECCEEEEEECSSSSEEEEEETTTEEEEEETTS-CEEECCSB--CTTSCBCBCCCEEEECTTSCEEEEECBCBCTTSCCC
T ss_pred CCCcceeEEEeCCCCEEEEEECCCeEEEEeCCC-cEEEEEec--cccccccCCCcEEEECCCCCEEEecCccCccccccc
Confidence 356899999999985 78899888999999964 44444432 567889999999999999999999997543322111
Q ss_pred ecceecCCceEEEEcCCC-ceEecCcc
Q psy4774 89 FDGLTSGSGSFIKIGPNT-QEVLQKQT 114 (120)
Q Consensus 89 ~~~~~~~~G~l~~~d~~~-~~~l~~~L 114 (120)
.....+.|+||++++++ +..+++++
T Consensus 146 -~~~~~~~G~v~~~~~dg~~~~~~~~~ 171 (314)
T d1pjxa_ 146 -RSMQEKFGSIYCFTTDGQMIQVDTAF 171 (314)
T ss_dssp -BTTSSSCEEEEEECTTSCEEEEEEEE
T ss_pred -ceeccCCceEEEEeecCceeEeeCCc
Confidence 11256889999999988 66666543
|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|