Psyllid ID: psy4774


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MFDGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKQTDKLGAK
ccccccccccccccccEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccccccccccccEEEcccccEEEEEccccccccccEEEEEEccccEEEEEcccccEEEEEEEcccccc
ccccccccccccccccEEEcccccEEEEEcHccEEEEcccccEEEEEEcccccccccccEEccccEEccccEEEEEcccccccHHHHHHHHHcccccEEEEEcccccEEEEEHHHHHccc
mfdgfkyeqqcgrplgmkfdkngalhvADAYFGLYKVNVTTGQTEQLISMdteidgakpqipnsvtvdsdgmvywsdsstkyklydglfdgltsgsgsfikigpnTQEVLQKQTDKLGAK
mfdgfkyeQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDteidgakpqipnsvtvdsdGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKqtdklgak
MFDGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKQTDKLGAK
*********QCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEI********NSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKI******************
**DGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKQTDKLG**
MFDGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQ*********
MFDGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKQTDKLG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEVLQKQTDKLGAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query120 2.2.26 [Sep-21-2011]
Q5ZIF1 415 Adipocyte plasma membrane yes N/A 0.683 0.197 0.493 9e-16
Q803F5 415 Adipocyte plasma membrane yes N/A 0.675 0.195 0.426 2e-13
B5X3B2 416 Adipocyte plasma membrane N/A N/A 0.85 0.245 0.384 1e-12
Q3T0E5 412 Adipocyte plasma membrane yes N/A 0.841 0.245 0.4 7e-12
Q9HDC9 416 Adipocyte plasma membrane yes N/A 0.683 0.197 0.433 1e-11
Q7TP48 376 Adipocyte plasma membrane yes N/A 0.683 0.218 0.421 2e-11
Q9D7N9 415 Adipocyte plasma membrane yes N/A 0.683 0.197 0.433 2e-11
P94111 335 Strictosidine synthase 1 no N/A 0.808 0.289 0.310 0.0001
>sp|Q5ZIF1|APMAP_CHICK Adipocyte plasma membrane-associated protein OS=Gallus gallus GN=APMAP PE=2 SV=1 Back     alignment and function desciption
 Score = 82.0 bits (201), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 1/83 (1%)

Query: 8   EQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTV 67
           E  CGRPLG++   N  L VADAY+GLY+VN  TG+T+ L+S  T I+G K    N +TV
Sbjct: 145 EPTCGRPLGIRVGPNNTLFVADAYYGLYEVNPGTGETKMLVSTKTLIEGQKLSFLNDLTV 204

Query: 68  DSDG-MVYWSDSSTKYKLYDGLF 89
             DG  +Y++DSS+K++  D LF
Sbjct: 205 TQDGRKIYFTDSSSKWQRRDFLF 227





Gallus gallus (taxid: 9031)
>sp|Q803F5|APMAP_DANRE Adipocyte plasma membrane-associated protein OS=Danio rerio GN=apmap PE=2 SV=1 Back     alignment and function description
>sp|B5X3B2|APMAP_SALSA Adipocyte plasma membrane-associated protein OS=Salmo salar GN=apmap PE=2 SV=1 Back     alignment and function description
>sp|Q3T0E5|APMAP_BOVIN Adipocyte plasma membrane-associated protein OS=Bos taurus GN=APMAP PE=2 SV=1 Back     alignment and function description
>sp|Q9HDC9|APMAP_HUMAN Adipocyte plasma membrane-associated protein OS=Homo sapiens GN=APMAP PE=1 SV=2 Back     alignment and function description
>sp|Q7TP48|APMAP_RAT Adipocyte plasma membrane-associated protein OS=Rattus norvegicus GN=Apmap PE=2 SV=2 Back     alignment and function description
>sp|Q9D7N9|APMAP_MOUSE Adipocyte plasma membrane-associated protein OS=Mus musculus GN=Apmap PE=1 SV=1 Back     alignment and function description
>sp|P94111|STS1_ARATH Strictosidine synthase 1 OS=Arabidopsis thaliana GN=SS1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
328714072 412 PREDICTED: LOW QUALITY PROTEIN: adipocyt 0.883 0.257 0.504 1e-25
270011245 486 hypothetical protein TcasGA2_TC030782, p 0.875 0.216 0.514 2e-25
91087333 503 PREDICTED: similar to hemomucin [Triboli 0.875 0.208 0.514 2e-25
215541377 423 putative hemomucin [Schistocerca gregari 0.891 0.252 0.541 1e-24
156551049 544 PREDICTED: adipocyte plasma membrane-ass 0.883 0.194 0.5 8e-24
383859542 572 PREDICTED: adipocyte plasma membrane-ass 0.916 0.192 0.464 2e-21
307210789 587 Adipocyte plasma membrane-associated pro 0.825 0.168 0.454 5e-21
332027099 578 Adipocyte plasma membrane-associated pro 0.883 0.183 0.424 7e-21
380024889 592 PREDICTED: adipocyte plasma membrane-ass 0.916 0.185 0.437 1e-20
328784314 590 PREDICTED: LOW QUALITY PROTEIN: adipocyt 0.916 0.186 0.437 2e-20
>gi|328714072|ref|XP_001947674.2| PREDICTED: LOW QUALITY PROTEIN: adipocyte plasma membrane-associated protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 3   DGFKYEQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTT---GQTEQLISMDTEIDGAKP 59
           DG   E  CGRPLG+  DK G L+VADAY+G++KVN+     G+ EQL+S+D  IDG  P
Sbjct: 109 DGLYDEHICGRPLGLSMDKTGFLYVADAYYGIFKVNLNPDQYGKKEQLVSLDDVIDGVHP 168

Query: 60  QIPNSVTVDSDGMVYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQE 108
           ++PNSV + SDG +YW+DS T YKL+DGL+     G+G  +K  P T+ 
Sbjct: 169 KLPNSVAIASDGTLYWTDSDTNYKLHDGLYTLFVDGTGRLLKYDPKTKR 217




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270011245|gb|EFA07693.1| hypothetical protein TcasGA2_TC030782, partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91087333|ref|XP_975599.1| PREDICTED: similar to hemomucin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|215541377|emb|CAT00690.1| putative hemomucin [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|156551049|ref|XP_001605615.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383859542|ref|XP_003705253.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307210789|gb|EFN87172.1| Adipocyte plasma membrane-associated protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332027099|gb|EGI67195.1| Adipocyte plasma membrane-associated protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380024889|ref|XP_003696221.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Apis florea] Back     alignment and taxonomy information
>gi|328784314|ref|XP_003250432.1| PREDICTED: LOW QUALITY PROTEIN: adipocyte plasma membrane-associated protein [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
UNIPROTKB|G1K318 414 C3H20orf3 "Uncharacterized pro 0.85 0.246 0.427 5.7e-16
UNIPROTKB|Q5ZIF1 415 APMAP "Adipocyte plasma membra 0.85 0.245 0.432 7.4e-16
FB|FBgn0015737 582 Hmu "Hemomucin" [Drosophila me 0.858 0.176 0.409 5.3e-14
ZFIN|ZDB-GENE-020919-1 415 apmap "adipocyte plasma membra 0.866 0.250 0.367 1.9e-13
TAIR|locus:2201841 390 SSL3 "strictosidine synthase-l 0.866 0.266 0.387 3.5e-13
UNIPROTKB|F1SAS3 400 LOC100157249 "Uncharacterized 0.85 0.255 0.394 6.2e-13
UNIPROTKB|Q3T0E5 412 APMAP "Adipocyte plasma membra 0.841 0.245 0.4 8.6e-13
MGI|MGI:1919131 415 Apmap "adipocyte plasma membra 0.85 0.245 0.384 1.9e-12
RGD|1308874 376 Apmap "adipocyte plasma membra 0.85 0.271 0.375 1.9e-12
UNIPROTKB|F1LLW3 386 RGD1308874 "Protein RGD1308874 0.85 0.264 0.375 2e-12
UNIPROTKB|G1K318 C3H20orf3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 5.7e-16, P = 5.7e-16
 Identities = 44/103 (42%), Positives = 63/103 (61%)

Query:     8 EQQCGRPLGMKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTV 67
             E  CGRPLG++   N  L VADAY+GLY+VN  TG+T+ L+S  T I+G K    N +TV
Sbjct:   145 EPTCGRPLGIRVGPNNTLFVADAYYGLYEVNPGTGETKMLVSTKTLIEGQKLSFLNDLTV 204

Query:    68 DSDGM-VYWSDSSTKYKLYDGLFDGLTSGSGSFIKIGPNTQEV 109
               DG  +Y++DSS+K++  D LF  +       ++    T+EV
Sbjct:   205 TQDGRKIYFTDSSSKWQRRDFLFLVMEGTDDGLLEYDTVTKEV 247




GO:0009058 "biosynthetic process" evidence=IEA
GO:0016844 "strictosidine synthase activity" evidence=IEA
GO:0004064 "arylesterase activity" evidence=IEA
GO:0009986 "cell surface" evidence=IEA
GO:0016020 "membrane" evidence=IEA
UNIPROTKB|Q5ZIF1 APMAP "Adipocyte plasma membrane-associated protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0015737 Hmu "Hemomucin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020919-1 apmap "adipocyte plasma membrane associated protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2201841 SSL3 "strictosidine synthase-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAS3 LOC100157249 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0E5 APMAP "Adipocyte plasma membrane-associated protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1919131 Apmap "adipocyte plasma membrane associated protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308874 Apmap "adipocyte plasma membrane associated protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LLW3 RGD1308874 "Protein RGD1308874" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
pfam0308889 pfam03088, Str_synth, Strictosidine synthase 7e-04
COG3386 307 COG3386, COG3386, Gluconolactonase [Carbohydrate t 7e-04
>gnl|CDD|111929 pfam03088, Str_synth, Strictosidine synthase Back     alignment and domain information
 Score = 35.8 bits (83), Expect = 7e-04
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 63  NSVTVDSD-GMVYWSDSSTKYKLYDGLFDGLTS-GSGSFIKIGPNTQEV 109
           N++ VD + G++Y++DSS++Y     +F  L    +G  +K  P+T+  
Sbjct: 1   NALDVDPETGVLYFTDSSSRYDRRQVIFAMLEGDKTGRLMKYDPSTKVT 49


Strictosidine synthase (E.C. 4.3.3.2) is a key enzyme in alkaloid biosynthesis. It catalyzes the condensation of tryptamine with secologanin to form strictosidine. Length = 89

>gnl|CDD|225921 COG3386, COG3386, Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 120
KOG1520|consensus 376 99.95
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 99.52
PF08450 246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.36
COG3386 307 Gluconolactonase [Carbohydrate transport and metab 99.19
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.92
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.88
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.87
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.81
COG4257 353 Vgb Streptogramin lyase [Defense mechanisms] 98.79
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.7
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.65
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.57
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.42
KOG4659|consensus 1899 98.25
KOG4659|consensus 1899 98.25
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 97.99
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 97.81
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 97.74
KOG4499|consensus310 97.69
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.63
PF03022 287 MRJP: Major royal jelly protein; InterPro: IPR0035 97.6
KOG1520|consensus376 97.47
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.34
COG3391 381 Uncharacterized conserved protein [Function unknow 97.2
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.0
PF05787524 DUF839: Bacterial protein of unknown function (DUF 96.93
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.78
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.77
COG3211616 PhoX Predicted phosphatase [General function predi 96.77
COG3391 381 Uncharacterized conserved protein [Function unknow 96.72
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.71
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 96.69
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.58
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.55
PRK11028330 6-phosphogluconolactonase; Provisional 96.51
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 96.48
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 96.39
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.39
PRK11028330 6-phosphogluconolactonase; Provisional 96.35
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.16
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.1
COG3823262 Glutamine cyclotransferase [Posttranslational modi 96.08
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.04
KOG4499|consensus310 95.95
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 95.82
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 95.57
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 95.54
COG3211616 PhoX Predicted phosphatase [General function predi 95.47
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.21
KOG1214|consensus 1289 95.13
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.12
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 94.69
PF13449 326 Phytase-like: Esterase-like activity of phytase 94.34
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 94.18
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 94.17
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 94.07
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 93.96
PF05787524 DUF839: Bacterial protein of unknown function (DUF 93.58
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 93.52
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 93.16
KOG1214|consensus 1289 93.05
PF14339 236 DUF4394: Domain of unknown function (DUF4394) 92.92
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 92.7
PF05096 264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.61
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 92.33
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 91.18
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 91.14
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 91.08
PF13449 326 Phytase-like: Esterase-like activity of phytase 90.78
PRK04792 448 tolB translocation protein TolB; Provisional 89.14
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 89.11
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 89.09
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 88.82
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 88.7
TIGR0380334 Gloeo_Verruco Gloeo_Verruco repeat. This model des 88.7
KOG1446|consensus311 88.66
PRK02888 635 nitrous-oxide reductase; Validated 88.6
PRK01029428 tolB translocation protein TolB; Provisional 88.59
PRK04792448 tolB translocation protein TolB; Provisional 88.38
PRK04922 433 tolB translocation protein TolB; Provisional 87.92
COG3204316 Uncharacterized protein conserved in bacteria [Fun 87.56
smart00284255 OLF Olfactomedin-like domains. 87.46
PRK05137435 tolB translocation protein TolB; Provisional 87.11
COG4946 668 Uncharacterized protein related to the periplasmic 86.97
PRK04043 419 tolB translocation protein TolB; Provisional 86.96
KOG0266|consensus 456 86.85
PRK03629429 tolB translocation protein TolB; Provisional 86.68
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 86.36
PRK05137 435 tolB translocation protein TolB; Provisional 86.32
KOG3567|consensus501 85.9
PF0749424 Reg_prop: Two component regulator propeller; Inter 85.57
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 85.53
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 85.43
PRK02889 427 tolB translocation protein TolB; Provisional 85.31
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 85.28
PRK00178430 tolB translocation protein TolB; Provisional 85.1
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 84.88
PRK04922433 tolB translocation protein TolB; Provisional 84.81
PRK01742429 tolB translocation protein TolB; Provisional 84.67
KOG0272|consensus459 84.48
PRK12690238 flgF flagellar basal body rod protein FlgF; Review 84.41
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 83.99
PRK00178 430 tolB translocation protein TolB; Provisional 83.84
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 83.6
PRK03629429 tolB translocation protein TolB; Provisional 83.6
PRK04043419 tolB translocation protein TolB; Provisional 83.59
KOG0319|consensus 775 83.22
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 83.19
PRK12689253 flgF flagellar basal body rod protein FlgF; Review 83.03
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 83.0
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 82.9
PRK02888 635 nitrous-oxide reductase; Validated 82.84
COG1520 370 FOG: WD40-like repeat [Function unknown] 82.71
PRK12636263 flgG flagellar basal body rod protein FlgG; Provis 81.78
COG3292 671 Predicted periplasmic ligand-binding sensor domain 81.36
KOG4649|consensus 354 81.05
smart00284255 OLF Olfactomedin-like domains. 80.76
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 80.59
>KOG1520|consensus Back     alignment and domain information
Probab=99.95  E-value=6.7e-28  Score=187.50  Aligned_cols=109  Identities=41%  Similarity=0.706  Sum_probs=102.1

Q ss_pred             CcccccCCCCccceEECCCC-cEEEEECCCCEEEEECCCCcEEEEeccccccCCCCCcCCCceEEcCCCCEEEEeCCCCc
Q psy4774           4 GFKYEQQCGRPLGMKFDKNG-ALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKY   82 (120)
Q Consensus         4 ~~~~~~~~g~P~Gl~~d~~G-~l~V~d~~~gi~~vd~~~g~~~~~~~~~~~~~g~~~~~pndl~v~~~G~iy~TDs~~~~   82 (120)
                      ..++++.||||+||+|+.+| +|||||++.|+++|++++|+.+.+++   +.+|+|+.+.|+++|+++|.||||||+.+|
T Consensus       107 ~~~~e~~CGRPLGl~f~~~ggdL~VaDAYlGL~~V~p~g~~a~~l~~---~~~G~~~kf~N~ldI~~~g~vyFTDSSsk~  183 (376)
T KOG1520|consen  107 SFETEPLCGRPLGIRFDKKGGDLYVADAYLGLLKVGPEGGLAELLAD---EAEGKPFKFLNDLDIDPEGVVYFTDSSSKY  183 (376)
T ss_pred             ceecccccCCcceEEeccCCCeEEEEecceeeEEECCCCCcceeccc---cccCeeeeecCceeEcCCCeEEEecccccc
Confidence            78889999999999999998 99999999999999999888777775   789999999999999999999999999999


Q ss_pred             ccccceecce-ecCCceEEEEcCCC--ceEecCccc
Q psy4774          83 KLYDGLFDGL-TSGSGSFIKIGPNT--QEVLQKQTD  115 (120)
Q Consensus        83 ~~~~~~~~~~-~~~~G~l~~~d~~~--~~~l~~~L~  115 (120)
                      ++++++.+++ ..++|||++|||.+  +++|+++|.
T Consensus       184 ~~rd~~~a~l~g~~~GRl~~YD~~tK~~~VLld~L~  219 (376)
T KOG1520|consen  184 DRRDFVFAALEGDPTGRLFRYDPSTKVTKVLLDGLY  219 (376)
T ss_pred             chhheEEeeecCCCccceEEecCcccchhhhhhccc
Confidence            9999999887 68999999999999  889999985



>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF14339 DUF4394: Domain of unknown function (DUF4394) Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03803 Gloeo_Verruco Gloeo_Verruco repeat Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3567|consensus Back     alignment and domain information
>PF07494 Reg_prop: Two component regulator propeller; InterPro: IPR011110 A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 2e-21
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 9e-08
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-05
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 4e-05
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 1e-04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 2e-04
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 3e-05
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 2e-04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 2e-04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 2e-04
2p4o_A 306 Hypothetical protein; putative lactonase, structur 8e-05
1rwi_B 270 Serine/threonine-protein kinase PKND; beta propell 7e-04
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Length = 322 Back     alignment and structure
 Score = 85.5 bits (211), Expect = 2e-21
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 6/108 (5%)

Query: 5   FKYEQQCGRPLGMKFD-KNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPN 63
            +    CGR   + ++ +N  L++ D Y+ L  V    G   QL    T +DG   +   
Sbjct: 73  AEKRPLCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLA---TSVDGVPFKWLY 129

Query: 64  SVTVD-SDGMVYWSDSSTKYKLYDGLFDGLT-SGSGSFIKIGPNTQEV 109
           +VTVD   G+VY++D ST Y          T   +G  IK  P+T+E 
Sbjct: 130 AVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLIKYDPSTKET 177


>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Length = 314 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 99.58
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 99.33
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.27
3sre_A 355 PON1, serum paraoxonase; directed evolution, 6-bla 99.2
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.14
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 99.14
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.1
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.05
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.99
3kya_A496 Putative phosphatase; structural genomics, joint c 98.98
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 98.98
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.96
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.94
2qe8_A343 Uncharacterized protein; structural genomics, join 98.94
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.91
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.91
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.88
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.87
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.86
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 98.86
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.84
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.83
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.8
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.8
3v65_B386 Low-density lipoprotein receptor-related protein; 98.79
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.79
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.78
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.78
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.78
1rwi_B 270 Serine/threonine-protein kinase PKND; beta propell 98.78
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.77
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.75
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.75
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.75
2p4o_A 306 Hypothetical protein; putative lactonase, structur 98.74
2p4o_A 306 Hypothetical protein; putative lactonase, structur 98.73
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.73
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.72
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.72
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.72
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.7
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.7
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.69
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.68
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.67
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.67
3kya_A496 Putative phosphatase; structural genomics, joint c 98.67
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.66
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.64
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.61
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.61
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.59
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 98.59
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.59
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.56
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 98.51
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.49
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.44
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.43
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.39
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.37
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.36
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.36
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 98.34
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 98.31
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.29
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.21
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 98.15
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 98.13
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 98.13
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.13
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 98.12
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 98.09
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.08
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.9
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 97.88
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 97.88
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.84
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.79
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.79
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.78
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.78
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.71
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.7
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.69
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.69
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.68
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.65
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.65
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 97.62
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.52
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.49
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.44
3q6k_A 381 43.2 kDa salivary protein; beta propeller, binding 97.42
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.4
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 97.38
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.35
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.34
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.34
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.29
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 97.28
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.25
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.24
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.24
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 97.2
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.18
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.13
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.07
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.04
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 97.02
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.95
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.93
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.8
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.72
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.62
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.56
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.55
3ott_A 758 Two-component system sensor histidine kinase; beta 96.47
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.47
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.43
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 96.37
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 96.33
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.3
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.21
2ece_A462 462AA long hypothetical selenium-binding protein; 96.19
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.18
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.18
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.13
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 96.1
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.03
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.97
3ott_A 758 Two-component system sensor histidine kinase; beta 95.83
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 95.81
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 95.38
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.24
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.23
2ece_A 462 462AA long hypothetical selenium-binding protein; 94.99
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 94.7
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.62
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.47
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 94.13
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.06
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 93.97
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.6
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 93.52
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 92.96
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 92.79
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 92.75
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.51
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.38
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 92.32
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 92.29
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.12
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.06
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 92.05
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 91.75
3ow8_A321 WD repeat-containing protein 61; structural genomi 91.6
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 91.56
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 91.49
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 91.18
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 91.14
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 90.94
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 90.4
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 90.22
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 90.18
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 90.18
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 90.11
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 90.08
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 90.06
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 89.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 89.33
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 89.32
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 89.08
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 88.66
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 88.36
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 88.35
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 87.85
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 87.71
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 87.35
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 87.3
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 87.2
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 86.48
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 86.36
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 86.34
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 86.32
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 86.16
3ow8_A321 WD repeat-containing protein 61; structural genomi 86.08
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 85.31
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 85.07
2ymu_A577 WD-40 repeat protein; unknown function, two domain 84.8
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 84.46
1k32_A 1045 Tricorn protease; protein degradation, substrate g 84.46
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 84.43
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 84.43
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 84.41
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 84.33
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 84.24
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 84.07
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 84.03
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 83.78
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 83.66
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 83.54
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 83.46
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 83.36
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 83.25
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 83.01
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 82.88
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 82.85
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 82.8
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 82.74
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 82.34
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 82.19
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 81.98
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 81.92
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 81.86
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 81.72
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 81.66
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 81.35
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 81.23
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 80.87
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 80.24
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
Probab=99.58  E-value=1.2e-15  Score=114.05  Aligned_cols=101  Identities=32%  Similarity=0.486  Sum_probs=78.1

Q ss_pred             CCCCccceEECC-CCcEEEEECCCCEEEEECCCCcEEEEeccccccCCCCCcCCCceEEcC-CCCEEEEeCCCCcccccc
Q psy4774          10 QCGRPLGMKFDK-NGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDS-DGMVYWSDSSTKYKLYDG   87 (120)
Q Consensus        10 ~~g~P~Gl~~d~-~G~l~V~d~~~gi~~vd~~~g~~~~~~~~~~~~~g~~~~~pndl~v~~-~G~iy~TDs~~~~~~~~~   87 (120)
                      .+++|.||++++ +|+|||||...+|++++++++++++++.   ...+.+++.||++++++ +|+|||||+...|.+.++
T Consensus        78 ~~~~p~gi~~~~~~g~l~v~d~~~~i~~~d~~~g~~~~~~~---~~~~~~~~~p~~i~~d~~~G~l~v~d~~~~~~~~~~  154 (322)
T 2fp8_A           78 LCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLAT---SVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGV  154 (322)
T ss_dssp             HHCCEEEEEEETTTTEEEEEETTTEEEEECTTCEECEEEES---EETTEECSCEEEEEECTTTCCEEEEESCSSCCTTCH
T ss_pred             cCCCCceEEEcCCCCcEEEEECCCCEEEEeCCCCEEEEecc---cCCCCcccccceEEEecCCCEEEEECCccccccccc
Confidence            457899999997 8999999998889999998777777764   34566788999999999 999999999865554433


Q ss_pred             eecce-ecCCceEEEEcCCC--ceEecCc
Q psy4774          88 LFDGL-TSGSGSFIKIGPNT--QEVLQKQ  113 (120)
Q Consensus        88 ~~~~~-~~~~G~l~~~d~~~--~~~l~~~  113 (120)
                      ..... ..+.|+|+++|+++  ++++.++
T Consensus       155 ~~~~~~~~~~g~v~~~d~~~~~~~~~~~~  183 (322)
T 2fp8_A          155 QQIMDTSDKTGRLIKYDPSTKETTLLLKE  183 (322)
T ss_dssp             HHHHHHTCCCEEEEEEETTTTEEEEEEEE
T ss_pred             ceehcccCCCceEEEEeCCCCEEEEeccC
Confidence            33322 35678999999875  5555544



>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d1pjxa_ 314 Diisopropylfluorophosphatase (phosphotriesterase, 99.64
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.24
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.11
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.06
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.99
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.88
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.86
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.85
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.78
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.72
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.69
d1v04a_ 340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.65
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.62
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.5
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.48
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.41
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.53
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.46
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.37
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.25
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.16
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 97.12
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 96.99
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 96.95
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.81
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.61
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.25
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.18
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 95.93
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.86
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.76
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 95.35
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 95.15
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 94.71
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 94.24
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.99
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 93.6
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 93.24
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.11
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 92.19
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 92.11
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 92.07
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.83
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 90.32
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 89.98
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 89.84
d1tl2a_235 Tachylectin-2 {Japanese horseshoe crab (Tachypleus 89.41
d1tbga_340 beta1-subunit of the signal-transducing G protein 89.4
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 88.97
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 88.8
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.73
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 87.68
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 87.6
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 87.52
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 86.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 86.67
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 85.52
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 84.58
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 84.28
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 84.17
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.97
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 83.9
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.68
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 83.39
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 80.09
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: SGL-like
domain: Diisopropylfluorophosphatase (phosphotriesterase, DFP)
species: Squid (Loligo vulgaris) [TaxId: 6622]
Probab=99.64  E-value=4.7e-16  Score=115.72  Aligned_cols=101  Identities=20%  Similarity=0.248  Sum_probs=76.0

Q ss_pred             CCCCccceEECCCCc-EEEEECCCCEEEEECCCCcEEEEeccccccCCCCCcCCCceEEcCCCCEEEEeCCCCcccccce
Q psy4774          10 QCGRPLGMKFDKNGA-LHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKLYDGL   88 (120)
Q Consensus        10 ~~g~P~Gl~~d~~G~-l~V~d~~~gi~~vd~~~g~~~~~~~~~~~~~g~~~~~pndl~v~~~G~iy~TDs~~~~~~~~~~   88 (120)
                      ..++|+||+++++|+ |||++..++|+++++++ ....++..  ..++.+++.|||++++++|+|||||+...+......
T Consensus        69 ~~g~P~Gl~~~~dg~~l~vad~~~~i~~~~~~g-~~~~~~~~--~~~g~~~~~pndl~~d~~G~lyvtd~~~~~~~~~~~  145 (314)
T d1pjxa_          69 YGGIPAGCQCDRDANQLFVADMRLGLLVVQTDG-TFEEIAKK--DSEGRRMQGCNDCAFDYEGNLWITAPAGEVAPADYT  145 (314)
T ss_dssp             EECCEEEEEECSSSSEEEEEETTTEEEEEETTS-CEEECCSB--CTTSCBCBCCCEEEECTTSCEEEEECBCBCTTSCCC
T ss_pred             CCCcceeEEEeCCCCEEEEEECCCeEEEEeCCC-cEEEEEec--cccccccCCCcEEEECCCCCEEEecCccCccccccc
Confidence            356899999999985 78899888999999964 44444432  567889999999999999999999997543322111


Q ss_pred             ecceecCCceEEEEcCCC-ceEecCcc
Q psy4774          89 FDGLTSGSGSFIKIGPNT-QEVLQKQT  114 (120)
Q Consensus        89 ~~~~~~~~G~l~~~d~~~-~~~l~~~L  114 (120)
                       .....+.|+||++++++ +..+++++
T Consensus       146 -~~~~~~~G~v~~~~~dg~~~~~~~~~  171 (314)
T d1pjxa_         146 -RSMQEKFGSIYCFTTDGQMIQVDTAF  171 (314)
T ss_dssp             -BTTSSSCEEEEEECTTSCEEEEEEEE
T ss_pred             -ceeccCCceEEEEeecCceeEeeCCc
Confidence             11256889999999988 66666543



>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure