Diaphorina citri psyllid: psy477


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MDSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRSCDEKQ
cccccccccEEEEEEccccHHHHHHHHHHcccCEEEEEEECcccCEEEEEEEEEcccccc
MDSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKF*RS*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRSCDEKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006479 [BP]protein methylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0008213, GO:0071704, GO:0043412, GO:0036211, GO:0043414, GO:0044237, GO:0008152, GO:0008150, GO:0032259
GO:0030307 [BP]positive regulation of cell growthprobableGO:0045927, GO:0040008, GO:0051128, GO:0001558, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0008276 [MF]protein methyltransferase activityprobableGO:0008168, GO:0016740, GO:0016741, GO:0003674, GO:0003824
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q87, chain B
Confidence level:confident
Coverage over the Query: 6-55
View the alignment between query and template
View the model in PyMOL